KEGG   Homo sapiens (human): 9699
Entry
9699              CDS       T01001                                 

Gene name
RIMS2, CRSDS, OBOE, RAB3IP3, RIM2
Definition
(RefSeq) regulating synaptic membrane exocytosis 2
  KO
K15297  regulating synaptic membrane exocytosis protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    9699 (RIMS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9699 (RIMS2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    9699 (RIMS2)
  Small GTPases and associated proteins
   Rab associated proteins
    9699 (RIMS2)
SSDB
Motif
Pfam: C2 FYVE_2 PDZ_6 PDZ
Other DBs
NCBI-GeneID: 9699
NCBI-ProteinID: NP_001093587
OMIM: 606630
HGNC: 17283
Ensembl: ENSG00000176406
Vega: OTTHUMG00000162097
Pharos: Q9UQ26(Tbio)
UniProt: Q9UQ26
LinkDB
Structure
PDB: 
1WFG 1V27

Position
8q22.3
AA seq 1349 aa
MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKK
LHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCG
GRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEKK
PKLHEQTQFQGPSGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASDRKRSPSVS
RDQNRRYDQREEREEYSQYATSDTAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRRS
HRHSKEYIVDDEDVESRDEYERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVS
RARHERRHSDVSLANADLEDSRISMLRMDRPSRQRSISERRAAMENQRSYSMERTREAQG
PSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHHLDPSSAVRKTKREKMETMLRN
DSLSSDQSESVRPPPPKPHKSKKGGKMRQISLSSSEEELASTPEYTSCDDVEIESESVSE
KGDMDYNWLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAM
LGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNI
ILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGML
RDVPQFLSGQLSSQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRN
PYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVR
EEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQ
RSKRISDSEVSDYDCDDGIGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDV
IGRTRSWSPSVPPPQSRNVEQGLRGTRTMTGHYNTISRMDRHRVMDDHYSPDRDRDCEAA
DRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHPRT
GSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTETGLAVEMRNWMTR
QASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQ
VGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPL
YQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSS
LVDPTLAPLTRRASQSSLESSTGPSYSRS
NT seq 4050 nt   +upstreamnt  +downstreamnt
atgtcggctcctgtcgggccccggggccgcctggctcccatcccggcggcctctcagccg
cctctgcagcccgagatgcctgacctcagccacctcacggaggaggagaggaaaatcatc
ctggccgtcatggataggcagaagaaagaagaggagaaggagcagtccgtgctcaaaaaa
ctgcatcagcagtttgaaatgtataaagagcaggtaaagaagatgggagaagaatcacag
caacagcaagaacagaagggtgatgcgccaacctgtggtatctgccacaaaacaaagttt
gctgatggatgtggccataactgttcatattgccaaacaaagttctgtgctcgttgtgga
ggtcgagtgtcattacgctcaaacaaggttatgtgggtatgtaatttgtgccgaaaacaa
caagaaatcctcactaaatcaggagcatggttttataatagtggatctaatacaccacag
caacctgatcaaaaggttcttcgagggctaagaaatgaggaggcacctcaggagaagaaa
ccaaaactacatgagcagacccagttccaaggaccctcaggtgacttatctgtacctgca
gtggagaaaagtcgatctcatgggctcacaagacagcattctattaaaaatgggtcaggc
gtgaagcatcacattgccagtgacatagcttcagacaggaaaagaagcccatctgtgtcc
agagatcagaatagaagatacgaccaaagggaagaaagagaggaatattcacagtatgct
acttcggataccgcaatgcctagatctccatcagattatgctgataggcgatctcaacat
gaacctcagttttatgaagactctgatcatttaagttatagggactccaacaggagaagt
cataggcattccaaagaatatattgtagatgatgaggatgtggaaagcagagatgaatac
gaaaggcaaaggagagaggaagagtaccagtcacgctaccgaagtgatccgaatttggcc
cgttatccagtaaagccacaaccctatgaagaacaaatgcggatccatgctgaagtgtcc
cgagcacggcatgagagaaggcatagtgatgtttctttggcaaatgctgatctggaagat
tccaggatttctatgctaaggatggatcgaccatcaaggcaaagatctatatcagaacgt
agagctgccatggaaaatcagcgatcttattcaatggaaagaactcgagaggctcaggga
ccaagttcttatgcacaaaggaccacaaaccatagtcctcctacccccaggaggagtcca
ctacccatagatagaccagacttgaggcgtactgactcactacggaaacagcaccactta
gatcctagctctgctgtaagaaaaacaaaacgggaaaaaatggaaacaatgttaaggaat
gattctctcagttcagaccagtcagagtcagtgagacctccaccaccaaagcctcataaa
tcaaagaaaggcggtaaaatgcgccagatttcgttgagcagttcagaggaggaattggct
tccacgcctgaatatacaagttgtgatgatgttgagattgaaagtgagagtgtaagtgaa
aaaggagacatggattacaactggttggatcatacgtcttggcatagcagtgaggcatcc
ccaatgtctttgcaccctgtaacctggcaaccatctaaagatggagatcgtttaattggt
cgcattttattaaataagcgtctaaaagatggaagtgtacctcgagattcaggagcaatg
cttggcttgaaggttgtaggaggaaagatgactgaatcaggtcggctttgtgcatttatt
actaaagtaaaaaaaggaagtttagctgatactgtaggacatcttagaccaggtgatgaa
gtattagaatggaatggaagactactgcaaggagccacatttgaggaagtgtacaacatc
attctagaatccaaacctgaaccacaagtagaacttgtagtttcaaggcctattggagat
ataccgcgaatacctgatagcacacatgcacaactggagtccagttctagctcctttgaa
tctcaaaaaatggatcgtccttctatttctgttacctctcccatgagtcctggaatgttg
agggatgtcccacagttcttatcaggacaactttcaagccaaagccttagtagaagaaca
acgccttttgttcctagggttcagataaaactatggtttgacaaggttggtcaccaatta
atagttacaattttgggagcaaaagatctcccttccagggaagatgggaggccaaggaat
ccttatgttaaaatttactttcttccagacagaagtgataaaaacaagagaagaactaaa
acagtaaagaaaacattggaacccaaatggaaccaaacattcatttattctccagtccac
cgaagagaatttcgggaacgaatgctagagattaccctttgggatcaagctcgtgttcga
gaggaagaaagtgaattcttaggcgagattttaattgaattagaaacagcattattagat
gatgagccacattggtacaaacttcagacgcatgatgtctcttcattgccacttccccac
ccttctccatatatgccacgaagacagctccatggagagagcccaacacggaggttgcaa
aggtcaaagagaataagtgatagtgaagtctctgactatgactgtgatgatggaattggt
gtagtatcagattatcgacatgatggtcgagatcttcaaagctcaacattatcagtgcca
gaacaagtaatgtcatcaaaccactgttcaccatcagggtctcctcatcgagtagatgtt
ataggaaggactagatcatggtcacccagtgtccctcctccacaaagtcggaatgtggaa
caggggcttcgagggacccgcactatgaccggacattataatacaattagccgaatggac
agacatcgtgtcatggatgaccattattctccagatagagacagggattgtgaagcagca
gatagacagccatatcacagatccagatcaacagaacaacggcctctccttgagcggacc
accacccgctccagatccactgaacgtcctgatacaaacctcatgaggtcgatgccttca
ttaatgactggaagatctgcccctccttcacctgccttatcgaggtctcatcctcgtact
gggtctgtccagacaagcccatcaagtactccagtcgcaggacgaaggggccgacagctt
ccacagcttccaccaaagggaacgttggatagaaaagcaggaggtaaaaaactaaggagc
actgtccaaagaagtacagaaacaggcctggccgtggaaatgaggaactggatgactcga
caggcaagccgagagtctacagatggtagcatgaacagctacagctcagaaggaaatctg
attttccctggtgttcgcttggcctctgatagccagttcagtgatttcctggatggcctt
ggccctgctcagctagtgggacgccagactctggcaacacctgcaatgggtgacattcag
gtaggaatgatggacaaaaagggacagctggaggtagaaatcatccgggcccgtggcctt
gttgtaaaaccaggttccaagacactgccagcaccgtatgtaaaagtgtatctattagat
aacggagtctgcatagccaaaaagaaaacaaaagtggcaagaaaaacgctggaacccctt
taccagcagctattatctttcgaagagagtccacaaggaaaagttttacagatcatcgtc
tggggagattatggccgcatggatcacaaatcttttatgggagtggcccagatactttta
gatgaactagagctatccaatatggtgatcggatggttcaaacttttcccaccttcctcc
ctagtagatccaaccttggcccctctgacaagaagagcttcccaatcatctctggaaagt
tcaactggaccttcttactctcgttcatag

DBGET integrated database retrieval system