KEGG   Homo sapiens (human): 9711
Entry
9711              CDS       T01001                                 

Gene name
RUBCN, KIAA0226, RUBICON, SCAR15
Definition
(RefSeq) rubicon autophagy regulator
  KO
K19330  run domain Beclin-1 interacting and cysteine-rich containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9711 (RUBCN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9711 (RUBCN)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    9711 (RUBCN)
SSDB
Motif
Pfam: zf-RING_9 RUN
Other DBs
NCBI-GeneID: 9711
NCBI-ProteinID: NP_055502
OMIM: 613516
HGNC: 28991
Ensembl: ENSG00000145016
Vega: OTTHUMG00000155452
Pharos: Q92622(Tbio)
UniProt: Q92622 Q8N4U6
LinkDB
Position
3q29
AA seq 972 aa
MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRD
MQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERA
VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNP
RLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNN
GSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLT
SPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQ
KPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP
ESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSE
QDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIR
LRRQQIRTKNLLPMYQEAEHGSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIR
RNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQK
LLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYR
CAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDL
LIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVP
GHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDI
IFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAE
ALALEAAVLEAT
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgcggccggagggcgcgggaatggagctcggaggcggcgaggagcgcctgcctgaggag
agcaggagggagcactggcagttgctgggtaatttgaagacgacggtggagggtttggta
tcaaccaacagccccaacgtctggtctaagtatggtggcttggagcggctttgcagggac
atgcagagcatcctctatcacgggcttatccgtgaccaggcgtgccgccgccagacggat
tactggcagttcgtgaaagacatccggtggctcagtccccactcagcccttcacgtggag
aagttcatcagcgtgcacgagaacgaccagagcagtgctgatggtgccagtgaacgtgct
gttgccgagctgtggctgcagcacagcctgcagtaccactgcctctcagcccagctccgg
cccctgctcggggatagacagtatatcagaaaattctacacagatgctgccttcctgcta
agtgacgctcatgtcacggccatgctgcagtgcctggaagcagtggaacagaacaacccc
cgcctcctggctcagatcgatgcgtccatgtttgccagaaagcacgagagcccgctcctg
gtgacaaagagccagagcctgacagccctgcccagttccacatacacccctccaaacagc
tatgctcagcattcctactttgggtccttctctagcctccaccaatccgtgcccaacaat
ggctcagagagaagatctacttcctttccactctctggccctccccggaaacctcaagaa
agcagagggcacgtctcaccagcagaggatcaaaccatccaagcccccccagtttcagtc
tctgcactagccagggattcccctttgaccccaaatgaaatgagctccagtactctgacc
agccccatagaggcatcctgggtcagcagccagaatgattccccaggtgatgccagtgag
gggcctgagtacctggccattggcaacttggacccccgaggccggactgccagctgtcag
agtcacagcagcaatgccgagagcagcagttccaatttgttctcctccagcagctcccag
aagccagattctgctgcctcttccttaggggaccaggaaggaggtggggagagccagctg
tccagtgtcctccgcaggtccagcttctcagaggggcagacactcactgtcaccagtggg
gcaaagaaaagccacattcgctcccattcggataccagcattgcctccaggggagctcca
gaatcctgcaatgataaggcgaagttgagaggccctttgccctactctggtcaaagcagt
gaagtcagcacacccagctctctgtacatggaatatgaaggtggtcggtacctgtgctca
ggggaaggcatgttccgaagaccatcagaaggacagtccctcatcagctacctctctgag
caagacttcggcagctgtgccgacctggaaaaggagaatgcccacttcagcatctcagag
tccttaattgctgccatcgagctaatgaagtgcaacatgatgagccagtgcctagaggag
gaggaagtggaagaggaagacagtgatagagagatccaggagctgaagcagaagatccgc
cttcggcgccagcaaatccgcaccaagaacctgctccccatgtaccaggaggctgagcac
ggaagctttcgggtcacctccagcagctcccagttcagctcacgtgattcggcacagctc
tctgactctggctctgctgatgaggttgatgaatttgaaatccaagatgctgacatcaga
aggaacacagcctcaagcagcaaatccttcgtttcctcccagtccttctcccactgcttc
ctgcactccacgtctgctgaggcggtggccatggggctcctgaagcagtttgaggggatg
cagcttccagccgcctcggagctggagtggcttgtcccggagcatgatgcccctcagaag
ctcctgcccattcctgactcactgcccatctcaccggatgacgggcagcacgctgacatc
tacaagctgcggattcgtgttcgtggcaacttggagtgggccccgccccggcctcagata
atttttaatgttcatccagccccaacgaggaaaattgccgtggccaagcagaattaccgc
tgtgcaggatgtggcatccggactgaccctgattacatcaagcgactgcggtactgtgag
tacctgggcaagtacttctgccagtgctgccacgagaatgcccagatggccatccccagc
cgggttctgcgcaagtgggacttcagcaagtactacgtcagcaacttctccaaggacctg
ctcattaagatctggaatgatcctctcttcaacgtgcaggacataaacagtgccctctat
aggaaggtcaagctgctcaatcaagtccggctgctgcgggtccagctgtgtcacatgaag
aacatgttcaagacttgccgactggccaaggagcttctggattcctttgacacagtccca
ggccacctgacagaggacctccacctgtactcactgaatgacctgactgcgaccaggaag
ggggagctggggccccggcttgctgagctcaccagggcaggggctacccatgtggagaga
tgcatgctctgccaagccaaaggcttcatctgtgagttctgtcagaatgaggatgacatc
atctttccctttgagctccataagtgccggacctgtgaagagtgtaaagcgtgttaccat
aaagcctgcttcaagtctggaagctgtccgcgctgcgagcggctgcaggcccggcgggag
gcactggccaggcagagcctggagtcttacctgtcagactacgaggaggagcccgcggaa
gcgctggccctggaagccgccgtcctggaggccacctga

DBGET integrated database retrieval system