KEGG   Homo sapiens (human): 973
Entry
973               CDS       T01001                                 

Gene name
CD79A, IGA, MB-1
Definition
(RefSeq) CD79a molecule
  KO
K06506  CD79A antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04662  B cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Disease
H00085  Agammaglobulinemias
H02434  Diffuse large B-cell lymphoma, not otherwise specified
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    973 (CD79A)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    973 (CD79A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    973 (CD79A)
CD molecules [BR:hsa04090]
 Proteins
  973 (CD79A)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set ITAM Ig_2 Adeno_E3_CR1 Ig_6
Other DBs
NCBI-GeneID: 973
NCBI-ProteinID: NP_001774
OMIM: 112205
HGNC: 1698
Ensembl: ENSG00000105369
Vega: OTTHUMG00000182678
Pharos: P11912(Tbio)
UniProt: P11912
LinkDB
Position
19q13.2
AA seq 226 aa
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSN
NANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCG
TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD
EYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
NT seq 681 nt   +upstreamnt  +downstreamnt
atgcctgggggtccaggagtcctccaagctctgcctgccaccatcttcctcctcttcctg
ctgtctgctgtctacctgggccctgggtgccaggccctgtggatgcacaaggtcccagca
tcattgatggtgagcctgggggaagacgcccacttccaatgcccgcacaatagcagcaac
aacgccaacgtcacctggtggcgcgtcctccatggcaactacacgtggccccctgagttc
ttgggcccgggcgaggaccccaatggtacgctgatcatccagaatgtgaacaagagccat
gggggcatatacgtgtgccgggtccaggagggcaacgagtcataccagcagtcctgcggc
acctacctccgcgtgcgccagccgccccccaggcccttcctggacatgggggagggcacc
aagaaccgaatcatcacagccgaggggatcatcctcctgttctgcgcggtggtgcctggg
acgctgctgctgttcaggaaacgatggcagaacgagaagctcgggttggatgccggggat
gaatatgaagatgaaaacctttatgaaggcctgaacctggacgactgctccatgtatgag
gacatctcccggggcctccagggcacctaccaggatgtgggcagcctcaacataggagat
gtccagctggagaagccgtga

DBGET integrated database retrieval system