KEGG   Homo sapiens (human): 9730
Entry
9730              CDS       T01001                                 

Gene name
DCAF1, RIP, VPRBP
Definition
(RefSeq) DDB1 and CUL4 associated factor 1
  KO
K11789  DDB1- and CUL4-associated factor 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00456  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9730 (DCAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9730 (DCAF1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9730 (DCAF1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9730 (DCAF1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Other
   9730 (DCAF1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     9730 (DCAF1)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 9730
NCBI-ProteinID: NP_055518
OMIM: 617259
HGNC: 30911
Ensembl: ENSG00000145041
Vega: OTTHUMG00000156895
Pharos: Q9Y4B6(Tbio)
UniProt: Q9Y4B6
LinkDB
Structure
PDB: 

Position
3p21.2
AA seq 1507 aa
MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDR
HPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAV
VFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLR
ELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDVVDGDQEEASGDMEIS
FHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRKAKQKLGFSSSDPDRMFVELS
NSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYI
DLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYL
SYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATMFFSICFSFRAVLELFDRY
DGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCMALRKYFEAHLAIKLEQVK
QSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLL
LQLISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAESVDVLDEAGSTVSTVGIS
IILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQNPKSSEH
TLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSSTVRQIISKLPL
FSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQ
SRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLP
RTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFI
RERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCK
NPVATCPPFSLFTPHQCPEPKQRRQAPINFTSRLNRRASFPKYGGVDGGCFDRHLIFSRF
RPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITH
LEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIA
HIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNM
NISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDD
LMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNM
DTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEED
DNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDD
IILSLNE
NT seq 4524 nt   +upstreamnt  +downstreamnt
atgactacagtagtggtacatgtggactccaaagctgagctcactaccctgctggagcag
tgggaaaaggaacatggcagtgggcaggacatggtacctatccttaccaggatgtctcaa
ttgattgaaaaagaaactgaagagtatcgtaaaggggatccagacccatttgatgatcga
catcctggtcgagctgatccagagtgtatgctgggccacttgctgagaatactcttcaag
aatgatgatttcatgaatgcactggtgaatgcatatgtgatgacaagccgagagccccct
ttaaacactgcagcttgcagactcctattagacatcatgccagggctggaaactgctgtc
gtctttcaagaaaaggagggaattgtcgagaatcttttcaaatgggcccgagaggccgat
caaccattgaggacatattctactggactgttaggaggtgctatggaaaatcaagacatt
gctgccaactatagagatgaaaattcacagctggtggcaatagtgcttcgaagactgagg
gagctacagctacaggaagtggctttgcggcaggaaaacaagcgtcccagtccacggaag
ctctcttctgaaccccttttgcctctggatgaggaggctgtggatatggactatggtgac
atggctgtagatgtagtggatggagaccaagaggaagcttctggagacatggagatctcc
tttcatcttgattcaggccacaagactagtagcagagtgaactcaacaaccaaacctgag
gatggaggattaaagaaaaacaagtcagcaaaacagggtgacagagagaactttaggaaa
gccaagcaaaagttgggtttctcatcttctgatccagatcgcatgtttgttgagctgtct
aatagcagttggtcagaaatgtctccctgggtgattggcaccaattataccctttatcct
atgactcctgctatcgagcagcgactcattctccaatatttgacccctctaggagaatat
caggagctacttcccatattcatgcaacttggatcacgggagctgatgatgttctatatt
gacctgaagcaaactaatgatgtcctgcttacatttgaggcactaaagcacctagcatct
ctcctgctccataacaaatttgccacagaatttgttgcgcatggtggagtacagaaatta
ctggaaatacctcgtccttctatggctgcaaccggtgtgtctatgtgtttgtattaccta
tcctacaatcaggatgccatggaaagagtttgcatgcatccccacaatgttctgtctgat
gtggtgaactataccctgtggttaatggagtgttctcatgcttcaggatgctgccatgct
accatgtttttttcaatttgcttctcatttcgggccgtcttggagctctttgaccgctat
gatggtcttcgtcgtctggtgaacttgatcagtactttggagattctaaatttggaagat
cagggtgcacttctgagtgatgatgaaatatttgctagccgccaaactgggaaacatacc
tgcatggccttgcgcaaatactttgaggctcacctggccattaaattggaacaagtgaag
cagtcacttcagaggactgagggtggcattcttgtccacccacaacccccgtacaaggca
tgctcatatactcatgaacagattgtggaaatgatggaatttttgatagaatatggccca
gcgcagctatattgggaaccagctgaagttttcctcaaactttcttgtgtgcaactcttg
ttgcagcttatttctattgcctgcaattggaagacctattatgcaaggaatgacactgtg
cgctttgctttggatgtcctggctattcttactgtggtgccaaaaatccagctccagttg
gcagaatcagtggacgtgttggatgaggctggatctacagtctctactgtaggtatcagc
attattttgggagtggctgagggtgagttcttcatccatgatgctgaaattcagaagtca
gcacttcagattatcatcaattgtgtgtgtggcccagataaccgaatatccagtattggt
aaatttatctctggtactcctcggagaaagctgcctcagaaccctaaaagcagtgagcac
accctggccaagatgtggaatgtggttcagtccaacaacggcatcaaggtgctcctgtcc
ttactgtccattaagatgcccatcacagatgcagaccaaatccgggccctggcctgcaaa
gccctagtgggcctgtctcgcagtagcactgtccggcagatcatcagtaaactgcccctt
ttcagcagctgccagatccagcagctgatgaaggagcctgtgctgcaggacaagcgcagt
gaccatgtcaagttctgcaagtatgctgctgaactcattgaacgggtgtcaggaaaacca
cttctcattggcactgatgtttccctagcacgactgcagaaagcagatgttgttgcccag
tcaaggatctccttccctgagaaagagctgcttttgttgatacgaaaccatcttatttct
aaagggcttggagaaacagcaaccgtgctgacaaaagaggctgacctgcccatgactgct
gcctcccattcttctgcctttaccccagtcactgctgctgcttctcctgtctctctaccc
cgaacccctcgtatcgctaatggcattgcaactcgtctgggcagccatgctgctgtgggt
gcctctgcgccttctgcccctactgctcatcctcagccacggcccccccagggtccgcta
gctctgcccggcccatcttatgcaggcaactcccctttgattggtagaatcagttttatc
agagagaggccatcaccctgcaatggcaggaaaatcagagtgttgcggcagaagtcggac
catggtgcctacagccaaagcccagccataaaaaaacagctggacagacatcttccttcc
ccacctacgctggacagtataatcacagagtatcttagagaacaacatgctcgctgcaag
aatccagttgccacctgcccacctttctccctctttactcctcaccaatgtcctgagcca
aaacagaggcggcaagcgccaataaactttacgtcaaggctaaaccgcagggcatcattt
ccaaagtatggaggggtggatggcggatgctttgataggcaccttatctttagcagattc
cgtcctatttcagtgttccgggaagccaatgaagatgagagtggcttcacctgctgtgca
ttctcagcacgggagcggttcctgatgcttggcacctgcacagggcagctgaagctctat
aatgtgtttagtggacaggaggaggccagctataactgtcacaactcagccatcacacat
cttgaaccttccagggatgggtccttgctgctgacatctgctacttggagccagcctttg
tctgcactttggggaatgaagtcagtatttgatatgaagcattccttcacagaagatcac
tatgttgagttcagtaagcactcccaggatcgggtcatcggcacaaaaggagacattgcc
cacatttatgatattcagactggcaacaagctgttgactctgtttaacccagatcttgcc
aacaactacaagaggaactgtgccacctttaatcctacagatgatcttgtcttaaatgat
ggcgtcctctgggatgtccgctctgcacaggccatccacaagtttgacaagttcaatatg
aacatcagtggtgttttccatccaaatggactggaggtgatcattaatactgagatttgg
gaccttcgaacttttcatcttttgcatactgttcccgctctggatcagtgtcgcgtggtg
ttcaatcacacgggaacagtgatgtatggagctatgttgcaggcagatgatgaagatgac
ttaatggaagagaggatgaaaagcccctttgggtcatccttccgaacatttaatgcaact
gactacaaacctatagcaaccattgatgtgaaacggaacatctttgacctgtgtacagac
accaaagactgctatcttgctgtcattgagaatcaaggcagcatggatgccctgaacatg
gacacagtatgcaggctgtatgaagtgggcaggcagcgtctggcagaggatgaggatgaa
gaggaggaccaggaagaggaagaacaggaggaagaagatgatgatgaagatgatgatgac
accgatgatttagatgagcttgacactgaccagttgctggaggcggagttggaggaggac
gacaataatgagaacgcaggggaagatggggacaatgacttctctccctctgatgaggag
ctagcaaaccttctagaggagggagaggacggggaggatgaagactctgatgcagatgag
gaggtggaactgatcctgggggacactgacagctctgacaactctgatttggaagatgac
atcatcttatctctgaatgagtga

DBGET integrated database retrieval system