KEGG   Homo sapiens (human): 975Help
Entry
975               CDS       T01001                                 

Gene name
CD81, CVID6, S5.7, TAPA1, TSPAN28
Definition
(RefSeq) CD81 molecule
  KO
K06508  CD81 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04662  B cell receptor signaling pathway
hsa05144  Malaria
hsa05160  Hepatitis C
Disease
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    975 (CD81)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    975 (CD81)
  09174 Infectious disease: parasitic
   05144 Malaria
    975 (CD81)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    975 (CD81)
   04090 CD molecules [BR:hsa04090]
    975 (CD81)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   975 (CD81)
CD molecules [BR:hsa04090]
 Proteins
  975 (CD81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 975
NCBI-ProteinID: NP_004347
OMIM: 186845
HGNC: 1701
Ensembl: ENSG00000110651
Vega: OTTHUMG00000009892
Pharos: P60033(Tchem)
UniProt: P60033 A0A024RCB7
LinkDB All DBs
Structure
PDB: 

Position
11p15.5
AA seq 236 aa AA seqDB search
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV
GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA
KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSN
IISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggagtggagggctgcaccaagtgcatcaagtacctgctcttcgtcttcaatttcgtc
ttctggctggctggaggcgtgatcctgggtgtggccctgtggctccgccatgacccgcag
accaccaacctcctgtatctggagctgggagacaagcccgcgcccaacaccttctatgta
ggcatctacatcctcatcgctgtgggcgctgtcatgatgttcgttggcttcctgggctgc
tacggggccatccaggaatcccagtgcctgctggggacgttcttcacctgcctggtcatc
ctgtttgcctgtgaggtggccgccggcatctggggctttgtcaacaaggaccagatcgcc
aaggatgtgaagcagttctatgaccaggccctacagcaggccgtggtggatgatgacgcc
aacaacgccaaggctgtggtgaagaccttccacgagacgcttgactgctgtggctccagc
acactgactgctttgaccacctcagtgctcaagaacaatttgtgtccctcgggcagcaac
atcatcagcaacctcttcaaggaggactgccaccagaagatcgatgacctcttctccggg
aagctgtacctcatcggcattgctgccatcgtggtcgctgtgatcatgatcttcgagatg
atcctgagcatggtgctgtgctgtggcatccggaacagctccgtgtactga

DBGET integrated database retrieval system