KEGG   Homo sapiens (human): 9771Help
Entry
9771              CDS       T01001                                 

Gene name
RAPGEF5, GFR, MR-GEF, REPAC
Definition
(RefSeq) Rap guanine nucleotide exchange factor 5
  KO
K08019  Rap guanine nucleotide exchange factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    9771 (RAPGEF5)
   04015 Rap1 signaling pathway
    9771 (RAPGEF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF DEP RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 9771
NCBI-ProteinID: NP_036426
OMIM: 609527
HGNC: 16862
Ensembl: ENSG00000136237
Vega: OTTHUMG00000152525
Pharos: Q92565(Tbio)
UniProt: Q92565 A8MQ07 Q5JPD2
LinkDB All DBs
Structure
PDB: 

Position
7p15.3
AA seq 883 aa AA seqDB search
MRMAVGSVKMQPPCESPALAAAAAVVAADGPLRRSPSAREPEREQPPASLRPRLRDLPAL
LRSGLTLRRKRSAAGGRTLSRRISNPYLEHTPSQIYGENSSCAGRALRNIIIVQAADLIK
DRVNLKGFYRRSCVGSELVDWLLEHCPFVQCRSMAIGVWQLLLDMGIMLSVDQHLYFQDT
YVFYQFSSDECSYLYCEFEREEEWQNGVKLLLQLVPLIPARGGICELSHQKIEDSEESSD
EILVRLTSAVQRELAAVIALKARKSAIEQDEENNDKHVAVTEAESVPDSQAGVMCKLQER
DEIGRIELVQKLAKENYQFLQTDKKEQEKSEHQDDEVTTVQVKEQDQSVLVLKKVQCCGP
APTAGSAESHWRYVVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDD
LCQALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYR
NVLDDVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTV
TETEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAEEDLALVAITFSGEKHEL
QPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLALELMNFD
WSLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLV
KKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSL
NHKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHC
RTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggccgtgggctccgtcaagatgcagccgccgtgcgagagcccggccctggcc
gccgcggcggcggtggtggcggcagacggccccctgcgccgcagccccagcgcccgggag
cccgagcgcgagcagccgccggcgtcgctgcggccgcggctgagggacctgcccgcgctg
ctgcggagcgggctcacgctgcggaggaagcggagcgccgctgggggccggactctatca
agaagaatatctaatccgtaccttgaacatacgccttcccagatttatggagagaattct
tcttgtgcaggaagagcattgaggaatattattatcgttcaagcagctgacctgataaag
gacagagtgaacctcaaggggttttacaggaggagctgcgttgggtcagagctggtagac
tggcttctagaacactgtcctttcgtccagtgcagatctatggccataggagtctggcaa
ctcctactggacatgggaattatgttatcagtggaccagcatctatactttcaagatact
tatgttttctaccagttttcctctgatgaatgtagctacttgtactgtgaatttgaaaga
gaagaagaatggcaaaatggtgtcaagcttttactgcaacttgtgcctctcattcctgcc
agaggtggcatctgtgaactgtctcatcagaaaattgaagactccgaagaaagcagtgat
gaaattcttgtgcgtctaacatctgcggtgcagagagagctagcagctgttattgctttg
aaagcaaggaagtctgcaattgaacaagatgaagaaaacaacgacaaacatgtagctgta
acagaagccgaaagtgttccagattctcaggcaggggtgatgtgcaagctccaggaaaga
gatgaaatcggacgaattgaactagtccagaagctggcaaaagaaaactatcagtttttg
cagacggacaaaaaagaacaggagaagtctgaacaccaagatgatgaagtgacgactgtt
caggttaaagagcaagaccagagcgtcctggtgctgaagaaagtgcagtgctgtggccca
gcccccacagctgggagtgcggagagccattggagatatgtggtggtgtccgggaccccg
gagaagattttggagcaccttttgaatgacttgcacctggaagaagtccaggacaaagaa
acagagaccctcctggatgacttccttctcacgtacactgtcttcatgacaactgatgac
ttgtgccaggctctgttaaggcactattctgctaagaagtatcaaggcaaagaggaaaac
tcagacgttccgcgtaggaaacgtaaagtcttgcatcttgtttcccagtggattgctctg
tacaaagactggttacctgaagatgaacattcaaaaatgtttttaaagaccatatatagg
aatgtactggatgatgtttatgaatatccaatacttgaaaaagaattgaaagaatttcaa
aagatacttggaatgcaccgtcgtcacactgtagatgaatattcaccacaaaaaaagaat
aaagcccttttccaccaattcagtcttaaggagaactggctccagcatagaggaactgtg
actgaaacggaggaaattttctgccacgtgtatataacagagcactcctatgtcagtgtg
aaggcaaaagtttccagtatagcccaagagatcctaaaagtcgtggcagaaaagatccag
tatgcagaagaggatctggctctggtggccatcacattctctggggaaaagcatgaactt
cagccaaatgacttagtcatctccaaatccctcgaggcatctggtcgaatatatgtctac
cggaaagacctggcggacactttgaacccatttgcagaaaatgaggaatcacagcaaagg
tcgatgaggattttgggaatgaacacttgggatcttgctctggaattaatgaattttgat
tggagtctattcaattcaattcacgagcaagagctgatctacttcacgttcagcagacag
ggaagtggggaacacactgcaaatctcagccttctgctccagagatgcaatgaggtccag
ctttgggtggccacggagattctgctctgcagccagctgggcaagcgagtgcagctggtg
aaaaaattcatcaaaattgcggctcactgcaaagcccagagaaacctgaattctttcttt
gccattgtgatgggtctcaacactgcttctgtcagtcgactgtcgcagacctgggagaaa
atccctgggaagtttaagaaacttttctctgaacttgaaagtttaacagatccttcccta
aatcacaaagcctacagagatgcattcaaaaagatgaagccaccaaaaatccctttcatg
cccttattgcttaaagatgtaacatttattcatgaaggaaataaaacttttttggataat
cttgtcaattttgaaaagctgcatatgatcgcagacactgtccgaaccctgagacactgc
aggactaaccagtttggtgacctgtctccaaaagagcatcaagagttaaagtcctatgtt
aatcacctgtatgtcattgacagccagcaggctctgtttgagctctcacacaggatcgag
cctcgggtgtga

DBGET integrated database retrieval system