KEGG   Homo sapiens (human): 9798Help
Entry
9798              CDS       T01001                                 

Gene name
IST1, CHMP8, OLC1, KIAA0174
Definition
(RefSeq) IST1 factor associated with ESCRT-III
  KO
K19476  vacuolar protein sorting-associated protein IST1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9798 (IST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ist1
Motif
Other DBs
NCBI-GeneID: 9798
NCBI-ProteinID: NP_001257904
OMIM: 616434
HGNC: 28977
Ensembl: ENSG00000182149
Vega: OTTHUMG00000137597
Pharos: P53990(Tbio)
UniProt: P53990
LinkDB All DBs
Structure
PDB: 

Position
16q22.2
AA seq 366 aa AA seqDB search
MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHII
REDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIV
ADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
SVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPS
ANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIV
GPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFE
ELKKKT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgggctctggatttaaagctgagcgcttaagagtgaatttgagattagtcataaat
cgccttaaactattggagaaaaagaaaacggaactggcccagaaagcaaggaaggagatt
gctgactatctggctgctgggaaagatgaacgagctcggatccgtgtggagcacattatc
cgggaagactacctcgtggaggccatggagatcctggagctgtactgtgacctgctgctg
gctcggtttggccttatccagtctatgaaggaactagattctggtctggctgaatctgtg
tctacattgatctgggctgctcctcgactccagtcagaagtggctgagttgaaaatagtt
gctgatcagctctgtgccaagtatagcaaggaatatggcaagctatgtaggaccaaccag
attggaactgtgaatgacaggctaatgcacaagctgagtgtggaagccccacccaaaatc
ctggtggagagatacctgattgaaattgcaaagaattacaacgtaccctatgaacctgac
tctgtggtcatggcagaagctcctcctggggtagagacagatcttattgatgttggattc
acagatgatgtgaagaaaggaggccctggaagaggagggagtggtggcttcacagcacca
gttggtggacctgatggaacggtgccaatgcccatgcccatgcccatgcctatgccatct
gcaaatacgcctttctcatatccactgccaaagggaccatcagatttcaatggactgcca
atggggacttatcaggcctttcccaatattcatccacctcagataccagcaactccccca
tcgtatgaatctgtagatgacattaatgctgataagaatatctcttctgcacagattgtt
ggtcctggacccaagccagaagcctctgcaaagcttccttccagacctgcagataactat
gacaactttgtcctaccagagttgccatctgtgccagacacactaccaactgcatctgct
ggtgccagcacctcagcatctgaagacattgactttgatgatctttcccggaggtttgaa
gagctgaaaaagaaaacatag

DBGET integrated database retrieval system