KEGG   Homo sapiens (human): 9817Help
Entry
9817              CDS       T01001                                 

Gene name
KEAP1, INrf2, KLHL19
Definition
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  kelch-like protein 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00048  Hepatocellular carcinoma
Drug target
Dimethyl fumarate: D03846
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9817 (KEAP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9817 (KEAP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    9817 (KEAP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9817 (KEAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9817 (KEAP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9817 (KEAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 9817
NCBI-ProteinID: NP_036421
OMIM: 606016
HGNC: 23177
Ensembl: ENSG00000079999
Vega: OTTHUMG00000180579
Pharos: Q14145(Tclin)
UniProt: Q14145 A0A024R7C0
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 624 aa AA seqDB search
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagatcccaggcctagcggggctggggcctgctgccgattcctgcccctgcag
tcacagtgccctgagggggcaggggacgcggtgatgtacgcctccactgagtgcaaggcg
gaggtgacgccctcccagcatggcaaccgcaccttcagctacaccctggaggatcatacc
aagcaggcctttggcatcatgaacgagctgcggctcagccagcagctgtgtgacgtcaca
ctgcaggtcaagtaccaggatgcaccggccgcccagttcatggcccacaaggtggtgctg
gcctcatccagccctgtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccattgagggtatccaccccaaggtcatggagcgcctcattgaattcgcc
tacacggcctccatctccatgggcgagaagtgtgtcctccacgtcatgaacggtgctgtc
atgtaccagatcgacagcgttgtccgtgcctgcagtgacttcctggtgcagcagctggac
cccagcaatgccatcggcatcgccaacttcgctgagcagattggctgtgtggagttgcac
cagcgtgcccgggagtacatctacatgcattttggggaggtggccaagcaagaggagttc
ttcaacctgtcccactgccaactggtgaccctcatcagccgggacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgaacagcga
cggttctacgtccaggcgctgctgcgggccgtgcgctgccactcgttgacgccgaacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtccgactcccgctgcaaggactac
ctggtcaagatcttcgaggagctcaccctgcacaagcccacgcaggtgatgccctgccgg
gcgcccaaggtgggccgcctgatctacaccgcgggcggctacttccgacagtcgctcagc
tacctggaggcttacaaccccagtgacggcacctggctccggttggcggacctgcaggtg
ccgcggagcggcctggccggctgcgtggtgggcgggctgttgtacgccgtgggcggcagg
aacaactcgcccgacggcaacaccgactccagcgccctggactgttacaaccccatgacc
aatcagtggtcgccctgcgcccccatgagcgtgccccgtaaccgcatcggggtgggggtc
atcgatggccacatctatgccgtcggcggctcccacggctgcatccaccacaacagtgtg
gagaggtatgagccagagcgggatgagtggcacttggtggccccaatgctgacacgaagg
atcggggtgggcgtggctgtcctcaatcgtctcctttatgccgtggggggctttgacggg
acaaaccgccttaattcagctgagtgttactacccagagaggaacgagtggcgaatgatc
acagcaatgaacaccatccgaagcggggcaggcgtctgcgtcctgcacaactgtatctat
gctgctgggggctatgatggtcaggaccagctgaacagcgtggagcgctacgatgtggaa
acagagacgtggactttcgtagcccccatgaagcaccggcgaagtgccctggggatcact
gtccaccaggggagaatctacgtccttggaggctatgatggtcacacgttcctggacagt
gtggagtgttacgacccagatacagacacctggagcgaggtgacccgaatgacatcgggc
cggagtggggtgggcgtggctgtcaccatggagccctgccggaagcagattgaccagcag
aactgtacctgttga

DBGET integrated database retrieval system