KEGG   Homo sapiens (human): 9821
Entry
9821              CDS       T01001                                 

Gene name
RB1CC1, ATG17, CC1, FIP200, PPP1R131
Definition
(RefSeq) RB1 inducible coiled-coil 1
  KO
K17589  RB1-inducible coiled-coil protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9821 (RB1CC1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    9821 (RB1CC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9821 (RB1CC1)
   05014 Amyotrophic lateral sclerosis
    9821 (RB1CC1)
   05016 Huntington disease
    9821 (RB1CC1)
   05017 Spinocerebellar ataxia
    9821 (RB1CC1)
   05022 Pathways of neurodegeneration - multiple diseases
    9821 (RB1CC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9821 (RB1CC1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9821 (RB1CC1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9821 (RB1CC1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9821 (RB1CC1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    9821 (RB1CC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9821 (RB1CC1)
SSDB
Motif
Pfam: ATG11 TBK1_ULD Jag_N
Other DBs
NCBI-GeneID: 9821
NCBI-ProteinID: NP_055596
OMIM: 606837
HGNC: 15574
Ensembl: ENSG00000023287
Vega: OTTHUMG00000164268
Pharos: Q8TDY2(Tbio)
UniProt: Q8TDY2
LinkDB
Structure
PDB: 
6DCE 6GMA

Position
8q11.23
AA seq 1594 aa
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTEL
VLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGD
LPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMK
AIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELL
ERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGK
LFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVP
LLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTA
GITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLD
LDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDT
NVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELV
CLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLE
DLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKE
NQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEE
SRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISEL
ISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQ
QEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNV
RTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLE
EKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMET
SMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRD
FQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVM
EKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
NT seq 4785 nt   +upstreamnt  +downstreamnt
atgaagttatatgtatttctggttaacactggaactactctaacatttgacactgaactt
acagtgcaaactgtggcagaccttaagcatgccattcaaagcaaatacaagattgctatt
caacaccaggtgctggtggtcaatggaggagaatgcatggctgcagatcgaagagtgtgt
acctacagtgctgggacggatacaaatccaatttttctttttaacaaagaaatgatctta
tgtgatcgtccacctgctattcctaaaactaccttttcgacagaaaatgacatggaaata
aaagttgaagaatctcttatgatgcctgcagtttttcatactgttgcttcaaggacacag
cttgcattggaaatgtatgaagttgccaagaaactttgttctttttgtgaaggtcttgta
catgatgaacatcttcaacaccaaggctgggctgcaatcatggccaacctggaggactgt
tcaaattcataccaaaagctacttttcaagtttgaaagtatttattcaaattatctgcag
tccatagaagacatcaagttaaaacttactcatttaggaactgcagtttcagtaatggcc
aagattccactgttggagtgcctaaccagacatagttacagagaatgtttgggaagactg
gattctttacctgaacatgaagactcagaaaaagctgagatgaaaagatccactgaactg
gtgctctctcctgatatgcctagaacaactaacgaatctttgttaacctcatttcccaag
tcagtggaacatgtgtccccagataccgcagatgctgaaagtggcaaagaaattagggaa
tcttgtcaaagtactgttcatcagcaagatgaaactacgattgacactaaagatggtgat
ctgcccttttttaatgtctctttgttagactggataaatgttcaagatagacctaatgat
gtggaatctttggtcaggaagtgctttgattctatgagcaggcttgatccaaggattatt
cgaccatttatagcagaatgccgtcaaactattgccaaacttgataatcagaatatgaaa
gccattaaaggacttgaagatcggctctacgccctggaccagatgattgctagctgtggc
cgactggtgaatgaacagaaagagcttgctcagggatttttagctaatcagaagagagct
gaaaacttaaaggatgcatctgtattacctgatttatgcctgagtcacgcaaatcagttg
atgattatgttgcaaaatcatagaaaactgttagatattaagcagaagtgtaccactgcc
aaacaagaactagcaaataacctacatgtcagactgaagtggtgttgctttgtaatgctt
catgctgatcaagatggagagaagttacaagctttgctccgcctcgtaatagagctgtta
gaaagagtcaaaattgttgaagctcttagtacagttcctcagatgtactgcttagctgtt
gttgaggttgtaagaagaaaaatgttcataaaacactacagggagtgggctggtgcttta
gtcaaagatggaaagagattatatgaagcagaaaaatcaaaaagggaatcctttgggaaa
ttatttaggaagtcttttttaagaaatcgtctgtttaggggactggactcctggccccct
tccttttgtactcaaaagcctcgaaagtttgactgtgaacttccagatatttcattaaaa
gatttacagtttctgcaatcattttgtccttcggaagttcagccattcctcagggttccc
ttactttgtgactttgaacctctacaccagcatgtacttgctctacataatttggtaaaa
gcagcacaaagtttggatgaaatgtcacagaccattacagatctactgagtgaacaaaag
gcatctgtgagtcagacatccccacagtctgcttcttcaccaaggatggaaagtacagca
ggaattacaactactacctcaccgagaactcctccaccactgactgttcaggatccctta
tgtcctgcagtttgtcccttagaagaattatctccagatagtattgatgcacatacgttt
gattttgaaactattccccatccaaacatagaacagactattcaccaagtttctttagac
ttggattcattagcagaaagtcctgaatcagattttatgtctgctgtgaatgagtttgta
atagaagaaaatttgtcgtctcctaatcctataagtgatccacaaagcccagaaatgatg
gtggaatcactttattcatcagttatcaatgcgatagacagtagacgaatgcaggataca
aatgtatgtggtaaggaggattttggagatcatacttctctgaatgtccagttggaaaga
tgtagagttgttgcccaagactctcacttcagtatacaaaccattaaggaagacctttgc
cactttagaacatttgtacaaaaagaacagtgtgacttctcaaattcattaaaatgtaca
gcagtagaaataagaaacattattgaaaaagtaaaatgttctctggaaataacactaaaa
gaaaaacatcaaaaagaactactgtctttaaaaaatgaatatgaaggtaaacttgacgga
ctaataaaggaaactgaagagaatgaaaacaaaattaaaaaattgaagggagagttagta
tgccttgaggaggttttacaaaataaagataatgaatttgctttggttaaacatgaaaaa
gaagctgtaatctgcctgcagaatgaaaaggatcagaagttgttagagatggaaaatata
atgcactctcaaaattgtgaaattaaagaactgaagcagtcacgagaaatagtgttagaa
gacttaaaaaagctccatgttgaaaatgatgagaagttacagttattgagggcagaactt
cagtccttggagcaaagtcatctaaaggaattagaggacacacttcaggttaggcacata
caagagtttgagaaggttatgacagaccacagagtttctttggaggaattaaaaaaggaa
aaccaacaaataattaatcaaatacaagaatctcatgctgaaattatccaggaaaaagaa
aaacagttacaggaattaaaactcaaggtttctgatttgtcagacacgagatgcaagtta
gaggttgaacttgcgttgaaggaagcagaaactgatgaaataaaaattttgctggaagaa
agcagagcccagcagaaggagaccttgaaatctcttcttgaacaagagacagaaaatttg
agaacagaaattagtaaactcaaccaaaagattcaggataataatgaaaattatcaggtg
ggcttagcagagctaagaactttaatgacaattgaaaaagatcagtgtatttccgagtta
attagtagacatgaagaagaatctaatatacttaaagctgaattaaacaaagtaacatct
ttgcataaccaagcatttgaaatagaaaaaaacctaaaagaacaaataattgaactgcag
agtaaattggattcagaattgagtgctcttgaaagacaaaaagatgaaaaaattacccaa
caagaagagaaatacgaagctattatccagaaccttgagaaagacagacaaaaattggtc
agcagccaggagcaagacagagaacagttaattcagaagcttaattgtgaaaaagatgaa
gctattcagactgccctaaaagaatttaaattggagagagaagttgttgagaaagagtta
ttagaaaaagttaaacatcttgagaatcaaatagcaaaaagtcctgccattgactctacc
agaggagattcttcaagcttagttgctgaacttcaagaaaagcttcaggaagaaaaagct
aagtttctagaacaacttgaagagcaagaaaaaagaaagaatgaagaaatgcaaaatgtt
cgaacatctttgattgcggaacaacagaccaattttaacactgttttaacaagagagaaa
atgagaaaagaaaacataataaatgatcttagtgataagttgaaaagtacaatgcagcaa
caagaacgggataaagatttgatagagtcactttctgaagatcgagctcgtttgcttgag
gaaaagaaaaagcttgaagaagaagtcagtaagttgcgtagtagcagttttgttccttca
ccatatgtagctacagccccagaactttatggagcttgtgcacctgaactcccaggtgaa
tcagatagatccgctgtggaaacagcagatgaaggaagagtggattcagcaatggagaca
agcatgatgtctgtacaagaaaatattcatatgttgtctgaagaaaaacagcggataatg
ctgttagaacgaacattgcaattgaaagaagaagaaaataaacggttaaatcaaagactg
atgtctcagagcatgtcttcagtatcttcaaggcattctgaaaagatagctattagagat
tttcaggtgggagatttggtactcatcatcctagacgaacgccatgacaattatgtgtta
tttactgttagtcctactttatattttctacattcagagtctctacctgccctggatctc
aaaccaggtgagggtgcttcaggtgcatctagaagaccctgggtacttggaaaagtaatg
gaaaaagaatactgtcaagccaaaaaggcacaaaacagatttaaagttcctttggggaca
aagttttacagagtgaaagccgtatcatggaataagaaagtataa

DBGET integrated database retrieval system