KEGG   Homo sapiens (human): 9829Help
Entry
9829              CDS       T01001                                 

Gene name
DNAJC6, DJC6, PARK19
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C6
  KO
K09526  DnaJ homolog subfamily C member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9829 (DNAJC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9829 (DNAJC6)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9829 (DNAJC6)
   04131 Membrane trafficking [BR:hsa04131]
    9829 (DNAJC6)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    9829 (DNAJC6)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   9829 (DNAJC6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    9829 (DNAJC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DnaJ Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 9829
NCBI-ProteinID: NP_055602
OMIM: 608375
HGNC: 15469
Ensembl: ENSG00000116675
Vega: OTTHUMG00000009066
Pharos: O75061(Tbio)
UniProt: O75061
LinkDB All DBs
Position
1p31.3
AA seq 913 aa AA seqDB search
MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYT
KGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAK
FHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFI
FCNLYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSP
IPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSM
YHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVT
LDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHY
GQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKK
PSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAG
QSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFL
NTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPT
GSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGG
GWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAA
DFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTM
HTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDA
WSEFENQGQKPLY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattctgaaaataaaggtgcctcatctccagacatggagcccagctatggggga
ggtctctttgacatggtaaaaggaggtgcagggaggctctttagtaacctaaaggacaac
ttgaaagacaccctcaaagacacatcttctagagtgatacaatctgtgaccagctacaca
aagggagatttagacttcacttatgttacctccagaattattgtgatgtcctttcctctg
gacaatgttgacataggattcaggaatcaggttgatgacattcgaagctttttggattcc
agacatcttgaccactacacagtatacaatctgtcacctaagtcttatcgaactgccaag
tttcacagccgggtctcagaatgcagttggcccattaggcaggctcccagtctgcacaac
ctttttgctgtgtgtcggaatatgtataactggctactgcagaatcccaaaaatgtctgt
gttgtccactgcttggatggacgggcggcatcatcaattctggttggtgctatgttcatt
ttctgtaatctctactctactcctggcccagccattcgattgctatatgcaaagcgacca
ggaattggactttcaccatcccataggagatacctgggctatatgtgtgacctactggca
gacaagccctaccgccctcacttcaagcctctcacaattaagtcgatcactgtcagtcca
ataccctttttcaacaaacagaggaatggatgtcgcccttactgtgatgtactcattgga
gaaaccaaaatatattcgacttgcacagattttgaacgaatgaaagaatatcgtgtccaa
gatggaaaaatcttcattcccttgaacatcactgtgcaaggagacgtggttgtttccatg
tatcacttgaggtcaaccattgggagccggctacaggctaaggtgaccaacacacagata
ttccagcttcagtttcacactggattcataccactggacacaacagttttaaagttcacc
aagcctgagttagatgcatgtgatgtaccagaaaaatatcctcagctatttcaggtgaca
ctggatgtagaactacagccccatgacaaagtaatagacttaactccaccatgggaacat
tactgcacaaaagatgtcaatcccagcatcctcttctcttctcaccaggaacatcaagat
acgctggccttaggaggacaggctccaatagatatccctccagacaaccccaggcattac
ggacaaagtggtttctttgcctctctctgttggcaagatcagaaatcggagaagtcattc
tgtgaggaggaccacgctgccctagtgaatcaggaaagtgagcaatcagatgatgaactt
ctgacactttccagtccgcatggcaatgccaatggtgacaagcctcatggagtcaagaag
cccagcaaaaagcagcaggagccagcagcccctccaccccctgaggatgtggaccttttg
ggcctggaagggtctgcaatgagtaacagcttctctccgccagcggctcctcccaccaat
tctgaactactgagtgacctgtttgggggtggaggtgcagctggtcccacccaggctgga
cagtcaggagtggaagatgtgtttcatcctagtggacctgcgtctacccagtcaacacca
cgccgctctgccacctccacctctgcgtctccaaccctaagagtgggagaaggtgccacc
tttgacccatttggagcaccttctaaaccatcaggtcaggatttgctgggttcttttctg
aacacatccagtgcttccagtgacccctttctccagccaacaagaagtccttcgcccaca
gtacatgcttctagtacgcctgctgtgaacattcagccagatgtttctggaggttgggac
tggcatgctaaaccaggaggctttggaatgggaagcaagtcagctgccaccagcccaacc
ggatcctcgcatggtactcccacccatcaaagcaaaccccagactctggatccttttgcc
gaccttgggacactaggtagttcttcctttgccagcaaacccaccacaccaactggattg
ggtggaggattcccgcctctcagctcgccacagaaggcgtctccccagcctatgggtggc
gggtggcagcagggaggtgcctacaactggcagcagccacagcctaagcctcagcccagc
atgccccactcctctccccagaaccgacccaactacaacgtgagcttctcagccatgcct
gggggccagaacgaacgtgggaaaggatcaagtaatttggaagggaaacaaaaagcagct
gattttgaagacctactctctggtcaaggtttcaatgctcacaaagacaaaaaggggcct
cggacaatagctgagatgagaaaggaggaaatggccaaggaaatggatcctgagaaatta
aagattctggaatggattgaaggcaaagaaagaaatatcagagcccttctttccacgatg
cataccgtactatgggctggggagaccaagtggaaaccagttggcatggcagacctggta
acaccagagcaggtgaagaaggtgtacaggaaggctgtcctggtggtgcacccagataaa
gctactgggcaaccctatgaacaatacgcaaagatgattttcatggagctcaatgatgcc
tggtctgaatttgaaaaccaaggccaaaagcccttatattaa

DBGET integrated database retrieval system