KEGG   Homo sapiens (human): 9839Help
Entry
9839              CDS       T01001                                 

Gene name
ZEB2, HSPC082, SIP-1, SIP1, SMADIP1, ZFHX1B
Definition
(RefSeq) zinc finger E-box binding homeobox 2
  KO
K23560  zinc finger homeobox protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Disease
H00908  Mowat-Wilson syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    9839 (ZEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9839 (ZEB2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    9839 (ZEB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-C2H2_jaz zf-met Homeodomain zf-H2C2_5 zf-C2H2_2 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 9839
NCBI-ProteinID: NP_055610
OMIM: 605802
HGNC: 14881
Ensembl: ENSG00000169554
Vega: OTTHUMG00000187624
Pharos: O60315(Tbio)
UniProt: O60315
LinkDB All DBs
Structure
PDB: 

Position
2q22.3
AA seq 1214 aa AA seqDB search
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQET
SPASVPNHESSPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTM
GPEATIQTAINNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAP
EELSRLGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEEN
FSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSS
PTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKA
EEISKLKGYHMKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACL
QSLTTDSRRQISNIKKEKLRTLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHE
RYLCKMNEEIKAVLQPHENIVPNKAGVFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLK
AYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSPSLERSSKPLAPNSN
PPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRS
NTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPP
QSAFPPATFMPPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQG
FQGELLDGAQDYMSGLDDMTDSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYE
HTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSY
CKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEH
EKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
TKSDHEEDNMEDGM
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccgatcatggcggatggcccccggtgcaagaggcgcaaacaagccaatccc
aggaggaaaaacgtggtgaactatgacaatgtagtggacacaggttctgaaacagatgag
gaagacaagcttcatattgctgaggatgacggtattgccaaccctctggaccaggagacg
agtccagctagtgtgcccaaccatgagtcctccccacacgtgagccaagctctgttgcca
agagaggaagaggaagatgaaataagggagggtggagtggaacacccctggcacaacaac
gagattctacaagcctctgtagatggtccagaagaaatgaaggaagactatgacactatg
gggccagaagccacgatccagaccgcaattaacaatggtacagtgaagaatgcaaattgc
acatcagattttgaggaatactttgccaaaagaaaactggaggaacgcgatggtcatgca
gtcagcatcgaggagtaccttcagcgcagtgacacagccattatttacccagaagcccct
gaggagctgtctcgccttggcacgccagaggccaatgggcaagaagaaaatgacctgcca
cctggaactccagatgcttttgcccaactgctgacctgcccctactgcgaccggggctac
aagcgcttgacatcactgaaggagcacatcaagtaccgccacgagaagaatgaagagaac
ttttcctgccctctctgtagctacacgtttgcctaccgcacccagctcgagcggcatatg
gtgacacacaagccagggacagatcagcaccaaatgctaacccaaggagcaggtaatcgc
aagttcaaatgcacagagtgtggcaaggccttcaaatataaacaccatctgaaagaacac
ctgcgaattcacagtggtgaaaaaccttacgagtgcccaaactgcaagaaacgtttctcc
cattctggttcctacagttcgcacatcagcagcaagaaatgtattggtttaatctctgta
aatggccgaatgagaaacaatatcaagacgggttcttcccctaattctgtttcttcttct
cctactaattcagccattacccagttaagaaacaagttggagaatggaaaaccacttagt
atgtctgaacagacaggcttacttaaaattaaaacagaaccactagacttcaatgactat
aaagttcttatggctacacacgggtttagtggcactagtccctttatgaatggtgggctt
ggagccaccagccctttaggagttcatccatctgctcagagtccaatgcagcacttaggt
gtagggatggaagcccctttacttgggtttcccaccatgaatagtaatttaagtgaggta
caaaaggttctacagattgtggacaatactgtttccaggcaaaaaatggactgcaaggct
gaagaaatttcaaagttgaaaggttatcacatgaaggatccatgctctcaacctgaggaa
caaggagttacttctcctaatattccgcctgtcggtcttccggtagtgagtcataatggt
gccactaaaagtattattgactatacgttggaaaaagtcaatgaagccaaagcttgcctc
cagagcttgactactgactcaaggagacagatcagtaatataaagaaagagaagctacgt
actttaatagatttggtcactgatgacaaaatgattgagaaccacaacatatccactcca
ttttcatgccagttctgtaaagaaagttttcctggccccatccctttgcatcagcatgaa
cgttacctttgtaagatgaatgaagagatcaaggcggtcctgcagcctcatgaaaacata
gtccccaacaaagccggagtttttgttgataataaagccctcctcttgtcatctgtactt
tctgagaaaggaatgacaagccccatcaacccatacaaggaccacatgtctgtactcaaa
gcatactatgctatgaacatggagcccaactccgatgaactgctgaaaatttccattgct
gtgggccttcctcaggaatttgtgaaggaatggtttgaacaacgaaaagtctaccagtac
tcaaattccaggtccccatccctggaaagaagctccaagccgttagctcccaacagtaac
cctcccacaaaagactctttattacccaggtctcctgtaaaacctatggactccataaca
tcaccatctatagcagaactccacaacagtgttacgaattgtgatcctcctctcaggcta
acaaaaccttcccattttaccaatattaaaccagttgaaaaattggaccactccaggagt
aatactccttctcccttaaatctttcctccacatcttctaaaaactcccacagtagttca
tacactccaaacagcttctcttctgaggagctccaggctgagcctttagacttgtcatta
ccaaaacaaatgaaagaacccaaaagtattatagccacaaagaacaaaacaaaagctagt
agcatcagtttagatcataacagtgtttcttcctcatctgaaaactcagatgagcctctg
aacttgacttttatcaagaaggaattttcaaattcaaataatctggacaacaaaagcact
aacccagtgttcagcatgaacccatttagtgccaaacctttatacacagctcttccacct
caaagcgcatttccccctgctactttcatgccaccagtccagaccagtattcctgggcta
cgaccatacccaggactggatcagatgagcttcctaccacatatggcctacacctaccca
actggagcagctacttttgctgatatgcagcaaaggagaaagtaccagcggaaacaagga
tttcagggagaattgcttgatggagcacaagactacatgtcaggcctagatgatatgaca
gactccgactcctgtctgtctcgcaaaaagatcaagaagacagagagtggcatgtatgca
tgtgacttatgtgacaagacattccagaaaagcagttcccttctgcgacataaatacgaa
cacacaggaaaaagaccacatcagtgtcagatttgtaagaaagcgtttaaacacaagcac
caccttatcgagcactcaaggcttcactcgggcgagaagccctatcagtgtgataaatgt
ggcaagcgcttctcacactcgggctcgtactcgcagcacatgaatcacaggtattcctac
tgcaagcgggaggcggaggagcgggaagcggcggagcgcgaggcgcgcgagaaagggcac
ttggaacccaccgagctgctgatgaaccgggcttacttgcagagcattacccctcagggg
tactctgactcggaggagagggagagtatgccgagggatggcgagagcgagaaggagcac
gagaaagaaggcgaggatggctacgggaagctgggcagacaggatggcgacgaggagttc
gaggaggaagaggaagaaagtgaaaataaaagtatggatacggatcccgaaacgatacga
gatgaagaagagactggagatcactccatggacgatagttcggaggatgggaaaatggaa
accaaatcagaccacgaggaagacaatatggaagatggcatgtaa

DBGET integrated database retrieval system