KEGG   Homo sapiens (human): 9855Help
Entry
9855              CDS       T01001                                 

Gene name
FARP2, FIR, FRG, PLEKHC3
Definition
(RefSeq) FERM, ARH/RhoGEF and pleckstrin domain protein 2
  KO
K06082  FERM, RhoGEF and pleckstrin domain protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9855 (FARP2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    9855 (FARP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH FERM_C FERM_N FERM_M FA PH_13 IQ_SEC7_PH PH_11 BTAD
Motif
Other DBs
NCBI-GeneID: 9855
NCBI-ProteinID: NP_055623
OMIM: 617586
HGNC: 16460
Ensembl: ENSG00000006607
Vega: OTTHUMG00000151574
Pharos: O94887(Tbio)
UniProt: O94887
LinkDB All DBs
Position
2q37.3
AA seq 1054 aa AA seqDB search
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgggggagatagaaggaacatacagagtcctgcagactgcagggatgcgcttgggtgcc
cagacccctgtgggagttagcacccttgagcctgggcagactctcttgcccagaatgcaa
gagaagcacctgcacctcagagtaaagctgctggacaacaccatggaaatatttgacatt
gagcctaaatgcgatggccaggtattactgacacaagtgtggaagcgtttaaacctggta
gaatgtgactacttcgggatggagtttcaaaatactcagtcctactggatttggcttgaa
cctatgaaacccatcattaggcaaatacgaaggccaaagaatgtggtgcttcgcctagct
gtaaaattttttccacctgatcctggtcagctacaagaagaatatacaagatacttgttt
gccttgcaacttaagagagacctgctggaagagcgtttgacctgtgctgacaccacagcg
gcccttctcacgtcccatctcctgcagtcggaaataggagattacgatgaaacgctggac
cgagagcacctcaaagtgaacgagtatttgcctggccagcagcactgccttgagaagata
ctagaattccatcagaagcacgtgggccagacacctgctgagtcggatttccaggtgctc
gaaattgctcgaaagttggaaatgtacggcatcagatttcacatggcttctgacagggaa
ggaaccaagattcaactggcagtttcccacatgggtgtactcgtgttccagggcaccacc
aaaatcaacactttcaactggtccaaggtccgtaaactaagcttcaagaggaaaagattt
cttatcaaacttcatccagaggttcatggaccttaccaggacacattagaatttttgttg
ggtagtagagatgaatgtaagaacttctggaagatttgtgtggagtatcacacctttttt
agacttttggaccaacctaagccaaaagcaaaagccgtcttcttcagccggggctcctcc
ttcagatacagtggaagaactcagaaacaactagtagattatttcaaagacagtggaatg
aagagaattccatatgaaagaaggcacagcaagacccacacgtccgttcgagctctgact
gcagacctaccaaaacagagcatctcattccccgagggattgaggactcctgcctcccca
tcttcagcgaatgccttttactcgctctctccctccactctggtcccctctggcctgcca
gagtttaaggacagcagcagctccctcacagatccccaggtttcctacgtcaagagtcca
gctgcagagaggcgcagtggagcagtggctggaggccccgacacaccatcggcccagccc
ctcgggccccccgcactccagcctggtccaggcctttccacgaagagtcctcagccttct
ccctccagccggaagagccccctgagtctgagccctgcatttcaggtgcctttgggccca
gctgaacagggctcatccccactcctgagccctgtcctcagtgatgctggcggagccggg
atggactgcgaggagcccagacacaagcgcgtgcctgcagacgaggcctacttcatagtc
aaagagattctcgctacagaacgaacatacctcaaggatttagaagttattaccgtgtgg
ttccgcagcgcagtggtgaaggaggacgccatgcctgcgactctgatgacgctgctcttc
tccaacatcgatcccatctatgagttccacagaggcttcctgcgcgaggtggagcagagg
ctggcactctgggaagggccctccaaagcccacacaaaaggcagtcatcaacgaatcggg
gacatcctgctcaggaacatgcgccagttaaaggagtttaccagctacttccaaagacat
gacgaggtcctaacagaactggaaaaggctaccaaacgctgtaagaagttggaggcagtg
tacaaggagtttgagctgcagaaggtctgctacttgcctctcaacacgttcctgctgaag
cccatccagcggctgctgcactaccgcctgctgctgcgccgcctatgcggacattacagc
cccgggcaccatgactacgctgactgccatgacgccctgaaagccatcacagaggtgacc
accacactacagcacattctcatccggctggagaacctgcagaagctaacggagctgcag
cgggacctggtgggcatagagaacctcattgctcctggcagggagttcatccgtgagggc
tgccttcacaagctcaccaagaagggcctgcagcagaggatgttttttctgttctcagat
atgttgctgtacacaagcaaaggagttgcagggaccagccacttccggatccggggcctc
cttcccctccaaggcatgctggtggaagaaagtgataacgagtggtctgttccacactgt
ttcaccatctacgcggctcagaaaacaatcgtggtggcagccagcactcggctggagaaa
gagaagtggatgctggacctgaactccgcgatccaagcagccaagagtggcggtgacacg
gcccctgcactgccaggccgcactgtgtgcactcgtccccccagatcccccaacgaggta
tctctggagcaggagtcagaagatgatgctcggggtgtccgcagctccctggaggggcat
ggccagcaccgggccaacaccacaatgcacgtgtgctggtaccggaacaccagcgtgtcc
agggcagaccacagtgcagctgtcgagaaccagctttcaggatatctgctaagaaagttc
aaaaacagtcatggctggcagaagctctgggtcgtctttaccaacttctgtttgttcttc
tacaaaactcatcaggatgactacccactggccagcctcccgctgctgggctacagcgtg
agcatccccagggaggccgatggcatacacaaagactatgttttcaagctccagttcaaa
tcccacgtctacttcttccgggctgagagcaagtacacatttgaaaggtggatggaggtg
atccagggggccagcagctcagccgggagggccccaagcatcgtgcaggatggcccccaa
ccctcctcagggctggaggggatggtcagggggaaggaggaatga

DBGET integrated database retrieval system