KEGG   Homo sapiens (human): 9882Help
Entry
9882              CDS       T01001                                 

Gene name
TBC1D4, AS160, NIDDM5
Definition
(RefSeq) TBC1 domain family member 4
  KO
K17902  TBC1 domain family member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9882 (TBC1D4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    9882 (TBC1D4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9882 (TBC1D4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    9882 (TBC1D4)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    9882 (TBC1D4)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    9882 (TBC1D4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC DUF3350 PID DUF632 RecR PTB
Motif
Other DBs
NCBI-GeneID: 9882
NCBI-ProteinID: NP_055647
OMIM: 612465
HGNC: 19165
Ensembl: ENSG00000136111
Vega: OTTHUMG00000017088
Pharos: O60343(Tbio)
UniProt: O60343
LinkDB All DBs
Structure
PDB: 

Position
13q22.2
AA seq 1298 aa AA seqDB search
MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPASPPSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGR
AQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQN
SGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIFLRV
ASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVVFLSGEDDPEKIEERKKSKELR
SLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNC
RAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLT
AQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLL
HMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISP
SLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENI
VEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLE
KLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQK
TVEQLRKLLPADALVNCDLLLRDLNCNPNNKAKIGNKP
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcccagctgcattcaggatgagccgttcccgcaccccctggagcccgagccg
ggcgtctcagctcagcccggccccgggaagccaagcgataagcggttccggctgtggtac
gttggggggtcgtgcctggaccacaggaccacgctgcctatgctgccctggctcatggcc
gagatccgcaggcgcagccagaagcccgaggcgggcggctgcggggcgccggcggcccga
gaggtgatcctggtgctcagcgcgcccttcctgcgttgcgtccccgcgccgggcgctggg
gcctcggggggcactagtccgtcggccacgcagcccaacccggcggtattcatcttcgag
cacaaggcgcagcatatctcgcgcttcatccacaacagccacgacctcacctactttgcc
tacctgatcaaggcgcagcccgacgaccccgagtcgcagatggcctgccacgttttccgc
gccacagaccccagccaggttcctgatgttattagcagcataaggcaattatctaaagcg
gccatgaaagaggatgccaaacccagcaaagataatgaggacgccttttacaactctcag
aagttcgaagtcctgtactgtggaaaggtgaccgtgacccacaagaaggccccctcaagc
ctcatcgatgactgcatggagaagttcagcctgcacgaacagcagcgcctgaagatccaa
ggggagcagcgcggtccggacccaggagaggacctggctgacttggaggtggtggtgccc
gggtcccccggagactgcctgccggaggaggctgacggcaccgacacccaccttggctta
cctgccggggccagccagcctgccctgaccagctctcgggtctgcttccctgagcggatt
ttggaagattctggctttgatgagcagcaggagtttcggtctcggtgcagcagtgtcacc
ggcgtgcaacggagagttcacgagggcagccagaaatcccagccgcgacggagacacgcg
agcgcacccagtcacgtccagccctcggactcggagaagaacaggaccatgctcttccag
gttgggcgatttgagattaaccttatcagtccagacactaaatcagttgtgctagaaaag
aattttaaagatatctcctcttgttctcagggtataaagcatgtggatcactttggcttt
atctgccgggagtctccagagcctggacttagccagtatatttgttatgtattccagtgt
gccagcgaatctctggttgatgaggtaatgctgactctgaaacaggccttcagtacggcg
gctgccctgcagagtgccaagacgcagattaaactgtgtgaggcctgcccgatgcactct
ttgcataagctctgtgaaaggattgaaggtctctacccaccaagagccaagctggtgata
cagaggcatctctcatcactgacagataatgagcaagctgacatctttgaaagagttcag
aaaatgaagccagtcagtgaccaggaagaaaatgaacttgtgattttacacctgaggcag
ctgtgtgaagccaagcagaagacacacgtgcacatcggggaaggcccttctactatttca
aatagtacaatcccagaaaatgcaacaagcagtggaaggttcaaacttgacattctgaaa
aataaagctaagagatccttaactagctccctggaaaatatcttctcaaggggagctaac
agaatgagaggtcggcttggaagtgtggacagttttgaacggtccaacagtcttgcttca
gagaaggactactcaccaggggattctccaccagggacaccgccagcgtccccaccgtcc
tcagcttggcaaacgtttcccgaagaggattccgactccccgcagtttcgaagacgggca
cacacgttcagccacccaccttcaagcacaaagagaaagctgaatttgcaggatgggagg
gctcagggtgtgcgttcccctctgctgaggcagagctccagtgaacagtgcagcaatctt
tcgtcagttcgacgcatgtacaaggagagtaattcttcctccagtcttccaagtcttcac
acttccttctctgccccttccttcactgccccctctttcctgaaaagcttttaccagaat
tcaggtagactgtccccacagtatgaaaatgaaatcagacaagacactgcttcagaatca
agtgatggagaagggagaaaaaggacctcatctacctgcagcaatgagtccctaagtgtg
ggaggaacctctgtcactcctcgccggatctcctggcggcagcgcattttcctcagggtt
gcttctcccatgaacaaatctccctcagcaatgcaacagcaagatggattggacaggaac
gagctgctgccactgtcccccctctctccaaccatggaggaggaaccgctggttgtattc
ctgtctggggaggatgacccagaaaagattgaagaaagaaagaaatcaaaagaactgagg
agcttgtggagaaaagctatacaccaacaaatcttgttacttcgaatggaaaaagaaaac
cagaaacttgaagcaagcagagatgaactccagtccagaaaagttaaattagactatgaa
gaagttggtgcatgtcagaaagaggtcttaataacttgggataagaagttgttaaactgc
agagctaaaatcagatgtgatatggaagatattcatactcttcttaaagaaggagttccc
aaaagtcgacgaggagaaatttggcagtttctggctttacagtaccgactcagacacaga
ttgcctaataaacaacagcctcctgacatatcctataaggaacttttgaagcagctcact
gctcagcagcatgcgattctcgtggatttaggaaggacgtttcctactcacccttacttt
tcagtacagcttgggccaggacagctgtcactgtttaacctcctgaaagcctattctttg
ctggacaaagaagtgggatactgtcaggggatcagctttgtggctggagtcctgcttctg
cacatgagtgaagagcaagcctttgaaatgctgaaattcctcatgtatgacctcggcttc
cgcaagcagtacagacctgacatgatgtcgctgcagattcaaatgtaccagctgtccagg
ctccttcatgactatcacagagatctctacaatcaccttgaagaaaatgaaatcagcccc
agtctttatgctgccccctggttcctcacattgtttgcctctcagttttcattaggattt
gtagccagagtttttgatattatttttcttcagggaactgaagttatattcaaggttgca
ctcagcctactgagcagccaagagacacttataatggaatgtgagagctttgaaaatatt
gttgagtttcttaaaaacacgctacctgatatgaatacctctgaaatggaaaaaattatt
acccaggtttttgagatggatatttctaagcagttgcatgcctatgaggtggaatatcat
gtgctacaggatgagcttcaggaatcttcatattcctgtgaggatagtgaaactttggag
aagctggagagggccaatagccaactgaaaagacaaaacatggacctcctagaaaaatta
caggtagctcatactaaaatccaggccttggaatcaaacctggaaaatcttttgacgaga
gagaccaaaatgaagtctttaatccggaccctggaacaagaaaaaatggcttatcaaaag
acagtggagcaactccggaagctgctgcccgcggatgctctagtcaattgtgacctgttg
ctgagagacctaaactgcaaccctaacaacaaagccaagataggaaataagccataa

DBGET integrated database retrieval system