KEGG   Homo sapiens (human): 9897Help
Entry
9897              CDS       T01001                                 

Gene name
WASHC5, KIAA0196, RTSC, RTSC1, SPG8
Definition
(RefSeq) WASH complex subunit 5
  KO
K18464  WASH complex subunit strumpellin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00266  Hereditary spastic paraplegia
H01568  3C syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9897 (WASHC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9897 (WASHC5)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    9897 (WASHC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Strumpellin GcpE
Motif
Other DBs
NCBI-GeneID: 9897
NCBI-ProteinID: NP_055661
OMIM: 610657
HGNC: 28984
Ensembl: ENSG00000164961
Vega: OTTHUMG00000164991
Pharos: Q12768(Tbio)
UniProt: Q12768
LinkDB All DBs
Position
8q24.13
AA seq 1159 aa AA seqDB search
MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSY
FKGPELWESKLDAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNMDDICKLLRSTGYSSQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
VDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIP
KLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQF
EFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHI
DQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RDRTVQDTLKTLMNAVSPLKSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQ
IANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPTDPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQKIPEIPADVVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgttggactttctagccgagaacaacctctgtggccaagcaatcctaaggattgtttcc
tgtggtaatgccatcattgctgaacttttgagactctctgagtttattcctgctgtgttc
aggttaaaagacagagctgatcaacagaaatatggagatatcatatttgatttcagctat
tttaagggtccagaattatgggaaagcaaactggatgctaagccagagctacaggattta
gatgaagaatttcgtgaaaacaacatagaaattgtgaccagattttatttagcatttcaa
agtgtacataaatatattgtagacttaaacagatatctagatgatctcaatgaaggggtt
tatattcagcaaaccttagaaactgtgcttctcaatgaagatggaaaacaacttctatgt
gaagcactgtacttatatggagttatgctactggtcattgaccaaaagattgaaggagaa
gtcagagagaggatgctggtttcttactaccgatacagtgctgctcgatcttctgctgat
tcaaatatggacgatatttgtaagctgcttcgaagtacaggttattctagccaaccaggt
gccaaaagaccatccaactatcccgagagctatttccagagagtgcctatcaacgaatcc
ttcatcagtatggtcattggtcgactgagatctgatgatatttacaaccaggtctcagcg
tatcctttgccggagcatcgcagcacagccctggcaaaccaagctgccatgctgtacgtg
attctctactttgagccttccatccttcacacccatcaagcaaaaatgagagagatagtg
gataaatactttccagataattgggtaattagtatttacatggggatcacagttaatcta
gtagatgcttgggaaccttacaaagctgcaaaaactgctttaaataataccctggacctt
tcaaatgtcagagaacaggcaagcagatatgctactgtcagtgaaagagtgcatgctcaa
gtgcagcaatttctaaaagaaggttatttaagggaggagatggttctggacaatatccca
aagcttctgaactgcctgagagactgcaatgttgccatccgatggctgatgcttcataca
gcagactcagcctgtgacccaaacaacaaacgccttcgtcaaatcaaggaccagattcta
acagactctcggtacaatcccaggatcctcttccagctgctgttagatactgcacaattt
gagtttatactcaaagagatgttcaagcaaatgctttcagaaaagcaaaccaaatgggag
cattacaagaaagagggttcggagcggatgactgagcttgctgatgtcttttcaggagtg
aaacccctaaccagagtggagaaaaatgaaaaccttcaagcttggttcagagagatctca
aaacaaatattgtctttaaattatgatgattctactgctgcgggcagaaaaactgtacaa
ctgatacaagctttggaagaggttcaagaattccaccagttggaatccaatctgcaagta
tgtcagtttcttgccgatactcgaaagtttcttcatcaaatgatcagaaccattaacatt
aaagaggaggttctgatcacaatgcagatcgttggggacctttctttcgcttggcagttg
attgacagtttcacatccatcatgcaagaaagcataagggtaaatccatccatggttact
aaactcagagctaccttcctaaagcttgcctctgccctcgatctgccccttcttcgtatt
aatcaggcaaatagccccgacctgctcagcgtgtcacagtactattctggagagttggta
tcctatgtgagaaaagttttgcagatcatcccagaaagcatgtttacatctcttctaaag
atcataaagcttcagacccacgacattattgaagtgcctacccgcctggacaaagacaag
ctgagggactatgctcagctaggcccacgatacgaggttgccaagcttactcatgctatt
tccatttttactgaaggcatcttaatgatgaaaacgactttggttggcatcatcaaggtg
gatccaaagcagttgctggaagatggaataaggaaagagcttgtgaagcgcgttgccttt
gccctgcataggggactgatattcaaccctcgagccaagccaagtgaattgatgcccaag
ctgaaagagttgggagcgaccatggatggattccatcgttcttttgaatacatacaggac
tatgtcaacatttatggtctgaagatttggcaggaagaagtatctcgtatcataaattac
aacgtggagcaagagtgtaataactttctaagaacgaagattcaagattggcaaagcatg
taccagtccactcatattccaatacccaagtttacccctgtggatgagtctgtaacgttt
attggtcgactctgcagagaaatcctgcggatcacagacccaaaaatgacatgtcacata
gaccagctgaacacttggtatgatatgaaaactcatcaggaagtgaccagcagccgcctc
ttctcagaaatccagaccaccttgggaacctttggtctaaatggcttagacaggcttctg
tgctttatgattgtaaaagagttacagaatttcctcagtatgtttcagaaaattatcctg
agagacagaactgttcaggacactttaaaaaccctcatgaatgctgtcagtcccctaaaa
agtattgtcgcaaattcaaataaaatttatttttccgccattgccaaaacacagaagatt
tggactgcgtatctcgaggctataatgaaggttgggcagatgcagattctgagacaacag
attgccaatgaattaaattattcttgtcggtttgattctaaacatctggcagctgctctg
gagaatctcaataaggctctcctagcagacattgaagcccactatcaggacccttcactt
ccttaccccaaagaagataacacacttttatatgaaatcacagcctatctggaggcagct
ggcattcacaacccactgaataagatatacataacaacaaagcgcttaccctattttcca
attgtaaactttctatttttgatcgctcagttgccaaaacttcaatacaacaaaaatctg
ggaatggtctgccgaaaaccgaccgacccggttgattggccaccacttgtcctgggactg
ctcactctgctgaagcagttccattcccggtacaccgagcagttcctggcgctgattggc
cagtttatctgctccacggtggagcagtgtacaagccagaagatacctgaaattcctgca
gatgttgtgggtgcccttctgttcctggaggattatgttcggtacacaaagctacccagg
agggttgctgaagcacatgtgcctaatttcatttttgatgagttcagaacagtgctgtaa

DBGET integrated database retrieval system