KEGG   Homo sapiens (human): 9900
Entry
9900              CDS       T01001                                 

Gene name
SV2A, SV2
Definition
(RefSeq) synaptic vesicle glycoprotein 2A
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Drug target
Brivaracetam: D08879
Levetiracetam: D00709
Piracetam: D01914
Seletracetam: D05817
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    9900 (SV2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9900 (SV2A)
Transporters [BR:hsa02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    9900 (SV2A)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Pentapeptide_4 MFS_3 Pentapeptide_3 Pentapeptide
Other DBs
NCBI-GeneID: 9900
NCBI-ProteinID: NP_001315603
OMIM: 185860
HGNC: 20566
Ensembl: ENSG00000159164
Vega: OTTHUMG00000012209
Pharos: Q7L0J3(Tclin)
UniProt: Q7L0J3
LinkDB
Position
1q21.2
AA seq 742 aa
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA
PSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
ASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaagagggcttccgagaccgggcagctttcatccgtggggccaaagacattgctaag
gaagtcaaaaagcatgcggccaagaaggtggtgaagggcctggacagagtccaggacgaa
tattcccgaagatcgtactcccgctttgaggaggaggatgatgatgatgacttccctgct
cccagtgatggttattaccgaggagaagggacccaggatgaggaggaaggtggtgcatcc
agtgatgctactgagggccatgacgaggatgatgagatctatgaaggggaatatcagggc
attccccgggcagagtctgggggcaaaggcgagcggatggcagatggggcgcccctggct
ggagtaagggggggcttgagtgatggggagggtccccctgggggccggggggaggcacaa
cgacggaaagaacgagaagaactggcccaacagtatgaagccatcctacgggagtgtggc
cacggccgcttccagtggacactgtattttgtgcttggtctggcgctgatggctgacggt
gtggaggtctttgtggtgggcttcgtgctgcccagcgctgagaaagacatgtgcctgtcc
gactccaacaaaggcatgctaggcctcatcgtctacctgggcatgatggtgggagccttc
ctctggggaggtctggctgaccggctgggtcggaggcagtgtctgctcatctcgctctca
gtcaacagcgtcttcgccttcttctcatcttttgtccagggttacggcactttcctcttc
tgccgcctactttctggggttgggattggagggtccatccccattgtcttctcctatttc
tccgagtttctggcccaggagaaacgaggggagcatttgagctggctctgcatgttttgg
atgattggtggcgtgtacgcagctgctatggcctgggccatcatcccccactatgggtgg
agttttcagatgggttctgcctaccagttccacagctggagggtcttcgtcctcgtctgc
gcctttccttctgtgtttgccattggggctctgaccacgcagcctgagagcccccgtttc
ttcctagagaatggaaagcatgatgaggcctggatggtgctgaagcaggtccatgatacc
aacatgcgagccaaaggacatcctgagcgagtgttctcagtaacccacattaagacgatt
catcaggaggatgaattgattgagatccagtcggacacagggacctggtaccagcgctgg
ggggtccgggccttgagcctaggggggcaggtttgggggaattttctctcctgttttggt
cccgaatatcggcgcatcactctgatgatgatgggtgtgtggttcaccatgtcattcagc
tactatggcctgaccgtctggtttcctgacatgatccgccatctccaggcagtggactac
gcatcccgcaccaaagtgttccccggggagcgcgtagagcatgtaacttttaacttcacg
ttggagaatcagatccaccgaggcgggcagtacttcaatgacaagttcattgggctgcgg
ctcaagtcagtgtcctttgaggattccctgtttgaagagtgttattttgaggatgtcaca
tccagcaacacgtttttccgcaactgcacattcatcaacactgtgttctataacactgac
ctgttcgagtacaagtttgtgaacagccgtctgataaacagtacattcctgcacaacaag
gagggctgcccgctagacgtgacagggacgggcgaaggtgcctacatggtatactttgtg
agcttcctggggacactggcagtgcttcctgggaatatcgtgtctgccctgctcatggac
aagatcggcaggctcagaatgcttgctggctccagcgtgatgtcctgtgtctcctgcttc
ttcctgtcttttgggaacagtgagtcggccatgatcgctctgctctgcctttttggcggg
gtcagcattgcatcctggaatgcgctggacgtgttgactgttgaactctacccctcagac
aagaggaccacagcttttggcttcctgaatgccctgtgtaagctggcagctgtgctgggg
atcagcatcttcacatccttcgtgggaatcaccaaggctgcacccatcctctttgcctca
gctgcccttgcccttggcagctctctggccctgaagctgcctgagacccgggggcaggtg
ctgcagtga

DBGET integrated database retrieval system