KEGG   Homo sapiens (human): 991Help
Entry
991               CDS       T01001                                 

Gene name
CDC20, CDC20A, bA276H19.3, p55CDC
Definition
(RefSeq) cell division cycle 20
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    991 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    991 (CDC20)
   04114 Oocyte meiosis
    991 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    991 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    991 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    991 (CDC20)
   03036 Chromosome and associated proteins [BR:hsa03036]
    991 (CDC20)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     991 (CDC20)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    991 (CDC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Motif
Other DBs
NCBI-GeneID: 991
NCBI-ProteinID: NP_001246
OMIM: 603618
HGNC: 1723
Ensembl: ENSG00000117399
Vega: OTTHUMG00000007420
Pharos: Q12834(Tbio)
UniProt: Q12834
LinkDB All DBs
Structure
PDB: 

Position
1p34.2
AA seq 499 aa AA seqDB search
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttcgcgttcgagagtgacctgcactcgctgcttcagctggatgcacccatc
cccaatgcaccccctgcgcgctggcagcgcaaagccaaggaagccgcaggcccggccccc
tcacccatgcgggccgccaaccgatcccacagcgccggcaggactccgggccgaactcct
ggcaaatccagttccaaggttcagaccactcctagcaaacctggcggtgaccgctatatc
ccccatcgcagtgctgcccagatggaggtggccagcttcctcctgagcaaggagaaccag
cctgaaaacagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaacctg
aacggttttgatgtagaggaagccaagatccttcggctcagtggaaaaccacaaaatgcg
ccagagggttatcagaacagactgaaagtactctacagccaaaaggccactcctggctcc
agccggaagacctgccgttacattccttccctgccagaccgtatcctggatgcgcctgaa
atccgaaatgactattacctgaaccttgtggattggagttctgggaatgtactggccgtg
gcactggacaacagtgtgtacctgtggagtgcaagctctggtgacatcctgcagcttttg
caaatggagcagcctggggaatatatatcctctgtggcctggatcaaagagggcaactac
ttggctgtgggcaccagcagtgctgaggtgcagctatgggatgtgcagcagcagaaacgg
cttcgaaatatgaccagtcactctgcccgagtgggctccctaagctggaacagctatatc
ctgtccagtggttcacgttctggccacatccaccaccatgatgttcgggtagcagaacac
catgtggccacactgagtggccacagccaggaagtgtgtgggctgcgctgggccccagat
ggacgacatttggccagtggtggtaatgataacttggtcaatgtgtggcctagtgctcct
ggagagggtggctgggttcctctgcagacattcacccagcatcaaggggctgtcaaggcc
gtagcatggtgtccctggcagtccaatgtcctggcaacaggagggggcaccagtgatcga
cacattcgcatctggaatgtgtgctctggggcctgtctgagtgccgtggatgcccattcc
caggtgtgctccatcctctggtctccccattacaaggagctcatctcaggccatggcttt
gcacagaaccagctagttatttggaagtacccaaccatggccaaggtggctgaactcaaa
ggtcacacatcccgggtcctgagtctgaccatgagcccagatggggccacagtggcatcc
gcagcagcagatgagaccctgaggctatggcgctgttttgagttggaccctgcgcggcgg
cgggagcgggagaaggccagtgcagccaaaagcagcctcatccaccaaggcatccgctga

DBGET integrated database retrieval system