KEGG   Homo sapiens (human): 993Help
Entry
993               CDS       T01001                                 

Gene name
CDC25A, CDC25A2
Definition
(RefSeq) cell division cycle 25A
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    993 (CDC25A)
   04218 Cellular senescence
    993 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    993 (CDC25A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    993 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    993 (CDC25A)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    993 (CDC25A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     993 (CDC25A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    993 (CDC25A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    993 (CDC25A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 993
NCBI-ProteinID: NP_001780
OMIM: 116947
HGNC: 1725
Ensembl: ENSG00000164045
Vega: OTTHUMG00000133535
Pharos: P30304(Tchem)
UniProt: P30304 A0A024R2S4
LinkDB All DBs
Structure
PDB: 

Position
3p21.31
AA seq 524 aa AA seqDB search
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggcccggagcccccgcaccgccgccgcctgctcttcgcctgcagcccccct
cccgcgtcgcagcccgtcgtgaaggcgctatttggcgcttcagccgccgggggactgtcg
cctgtcaccaacctgaccgtcactatggaccagctgcagggtctgggcagtgattatgag
caaccactggaggtgaagaacaacagtaatctgcagagaatgggctcctccgagtcaaca
gattcaggtttctgtctagattctcctgggccattggacagtaaagaaaaccttgaaaat
cctatgagaagaatacattccctacctcagaagctgttgggatgtagtccagctctgaag
aggagccattctgattctcttgaccatgacatctttcagctcatcgacccagatgagaac
aaggaaaatgaagcctttgagtttaagaagccagtaagacctgtatctcgtggctgcctg
cactctcatggactccaggagggtaaagatctcttcacacagaggcagaactctgcccca
gctcggatgctttcctcaaatgaaagagatagcagtgaaccagggaatttcattcctctt
tttacaccccagtcacctgtgacagccactttgtctgatgaggatgatggcttcgtggac
cttctcgatggagagaatctgaagaatgaggaggagaccccctcgtgcatggcaagcctc
tggacagctcctctcgtcatgagaactacaaaccttgacaaccgatgcaagctgtttgac
tccccttccctgtgtagctccagcactcggtcagtgttgaagagaccagaacgatctcaa
gaggagtctccacctggaagtacaaagaggaggaagagcatgtctggggccagccccaaa
gagtcaactaatccagagaaggcccatgagactcttcatcagtctttatccctggcatct
tcccccaaaggaaccattgagaacattttggacaatgacccaagggaccttataggagac
ttctccaagggttatctctttcatacagttgctgggaaacatcaggatttaaaatacatc
tctccagaaattatggcatctgttttgaatggcaagtttgccaacctcattaaagagttt
gttatcatcgactgtcgatacccatatgaatacgagggaggccacatcaagggtgcagtg
aacttgcacatggaagaagaggttgaagacttcttattgaagaagcccattgtacctact
gatggcaagcgtgtcattgttgtgtttcactgcgagttttcttctgagagaggtccccgc
atgtgccggtatgtgagagagagagatcgcctgggtaatgaataccccaaactccactac
cctgagctgtatgtcctgaaggggggatacaaggagttctttatgaaatgccagtcttac
tgtgagccccctagctaccggcccatgcaccacgaggactttaaagaagacctgaagaag
ttccgcaccaagagccggacctgggcaggggagaagagcaagagggagatgtacagtcgt
ctgaagaagctctga

KEGG   Homo sapiens (human): 994Help
Entry
994               CDS       T01001                                 

Gene name
CDC25B
Definition
(RefSeq) cell division cycle 25B
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04110  Cell cycle
hsa04914  Progesterone-mediated oocyte maturation
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00455  CDC25-Cell cycle G2/M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    994 (CDC25B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    994 (CDC25B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    994 (CDC25B)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    994 (CDC25B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    994 (CDC25B)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    994 (CDC25B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     994 (CDC25B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    994 (CDC25B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    994 (CDC25B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 994
NCBI-ProteinID: NP_068659
OMIM: 116949
HGNC: 1726
Ensembl: ENSG00000101224
Vega: OTTHUMG00000031764
Pharos: P30305(Tchem)
UniProt: P30305 B3KS38 Q6MZW8
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 580 aa AA seqDB search
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgccccagccggagcccgcgccaggctcggctctcagtccagcaggcgtgtgc
ggtggcgcccagcgtccgggccacctcccgggcctcctgctgggatctcatggcctcctg
gggtccccggtgcgggcggccgcttcctcgccggtcaccaccctcacccagaccatgcac
gacctcgccgggctcggcagcgaaaccccaaagagtcaggtagggaccctgctcttccgc
agccgcagccgcctgacgcacctatccctgtctcgacgggcatccgaatcctccctgtcg
tctgaatcctccgaatcttctgatgcaggtctctgcatggattcccccagccctatggac
ccccacatggcggagcagacgtttgaacaggccatccaggcagccagccggatcattcga
aacgagcagtttgccatcagacgcttccagtctatgccggtgaggctgctgggccacagc
cccgtgcttcggaacatcaccaactcccaggcgcccgacggccggaggaagagcgaggcg
ggcagtggagctgccagcagctctggggaagacaaggagaatgatggatttgtcttcaag
atgccatggaagcccacacatcccagctccacccatgctctggcagagtgggccagccgc
agggaagcctttgcccagagacccagctcggcccccgacctgatgtgtctcagtcctgac
cggaagatggaagtggaggagctcagccccctggccctaggtcgcttctctctgacccct
gcagagggggatactgaggaagatgatggatttgtggacatcctagagagtgacttaaag
gatgatgatgcagttcccccaggcatggagagtctcattagtgccccactggtcaagacc
ttggaaaaggaagaggaaaaggacctcgtcatgtacagcaagtgccagcggctcttccgc
tctccgtccatgccctgcagcgtgatccggcccatcctcaagaggctggagcggccccag
gacagggacacgcccgtgcagaataagcggaggcggagcgtgacccctcctgaggagcag
caggaggctgaggaacctaaagcccgcgtcctccgctcaaaatcactgtgtcacgatgag
atcgagaacctcctggacagtgaccaccgagagctgattggagattactctaaggccttc
ctcctacagacagtagacggaaagcaccaagacctcaagtacatctcaccagaaacgatg
gtggccctattgacgggcaagttcagcaacatcgtggataagtttgtgattgtagactgc
agatacccctatgaatatgaaggcgggcacatcaagactgcggtgaacttgcccctggaa
cgcgacgccgagagcttcctactgaagagccccatcgcgccctgtagcctggacaagaga
gtcatcctcattttccactgtgaattctcatctgagcgtgggccccgcatgtgccgtttc
atcagggaacgagaccgtgctgtcaacgactaccccagcctctactaccctgagatgtat
atcctgaaaggcggctacaaggagttcttccctcagcacccgaacttctgtgaaccccag
gactaccggcccatgaaccacgaggccttcaaggatgagctaaagaccttccgcctcaag
actcgcagctgggctggggagcggagccggcgggagctctgtagccggctgcaggaccag
tga

KEGG   Homo sapiens (human): 995Help
Entry
995               CDS       T01001                                 

Gene name
CDC25C, CDC25, PPP1R60
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05170  Human immunodeficiency virus 1 infection
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00458  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    995 (CDC25C)
   04114 Oocyte meiosis
    995 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    995 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    995 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    995 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    995 (CDC25C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    995 (CDC25C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     995 (CDC25C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     995 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    995 (CDC25C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    995 (CDC25C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese M-inducer_phosp
Motif
Other DBs
NCBI-GeneID: 995
NCBI-ProteinID: NP_001274511
OMIM: 157680
HGNC: 1727
Ensembl: ENSG00000158402
Vega: OTTHUMG00000129203
Pharos: P30307(Tchem)
UniProt: P30307
LinkDB All DBs
Structure
PDB: 

Position
5q31.2
AA seq 473 aa AA seqDB search
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaactcttctcatccacaagagaggaaggaagctctggctcaggacccagt
tttaggtctaatcaaaggaaaatgttaaacctgctcctggagagagacacttcctttacc
gtctgtccagatgtccctagaactccagtgggcaaatttcttggtgattctgcaaaccta
agcattttgtctggaggaaccccaaaacgttgcctcgatctttcgaatcttagcagtggg
gagataactgccactcagcttaccacttctgcagaccttgatgaaactggtcacctggat
tcttcaggacttcaggaagtgcatttagctgggatgaatcatgaccagcacctaatgaaa
tgtagcccagcacagcttctttgtagcactccgaatggtttggaccgtggccatagaaag
agagatgcaatgtgtagttcatctgcaaataaagaaaatgacaatggaaacttggtggac
agtgaaatgaaatatttgggcagtcccattactactgttccaaaattggataaaaatcca
aacctaggagaagaccaggcagaagagatttcagatgaattaatggagttttccctgaaa
gatcaagaagcaaaggtgagcagaagtggcctatatcgctccccgtcgatgccagagaac
ttgaacaggccaagactgaagcaggtggaaaaattcaaggacaacacaataccagataaa
gttaaaaaaaagtatttttctggccaaggaaagctcaggaagggcttatgtttaaagaag
acagtctctctgtgtgacattactatcactcagatgctggaggaagattctaaccagggg
cacctgattggtgatttttccaaggtatgtgcgctgccaaccgtgtcagggaaacaccaa
gatctgaagtatgtcaacccagaaacagtggctgccttactgtcggggaagttccagggt
ctgattgagaagttttatgtcattgattgtcgctatccatatgagtatctgggaggacac
atccagggagccttaaacttatatagtcaggaagaactgtttaacttctttctgaagaag
cccatcgtccctttggacacccagaagagaataatcatcgtgttccactgtgaattctcc
tcagagaggggcccccgaatgtgccgctgtctgcgtgaagaggacaggtctctgaaccag
tatcctgcattgtactacccagagctatatatccttaaaggcggctacagagacttcttt
ccagaatatatggaactgtgtgaaccacagagctactgccctatgcatcatcaggaccac
aagactgagttgctgaggtgtcgaagccagagcaaagtgcaggaaggggagcggcagctg
cgggagcagattgcccttctggtgaaggacatgagcccatga

DBGET integrated database retrieval system