KEGG   Homo sapiens (human): 995Help
Entry
995               CDS       T01001                                 

Gene name
CDC25C, CDC25, PPP1R60
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05170  Human immunodeficiency virus 1 infection
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00458  HIV Vpr to CDC25-cell cycle G2M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    995 (CDC25C)
   04114 Oocyte meiosis
    995 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    995 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    995 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    995 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    995 (CDC25C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    995 (CDC25C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     995 (CDC25C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     995 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    995 (CDC25C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    995 (CDC25C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese M-inducer_phosp
Motif
Other DBs
NCBI-GeneID: 995
NCBI-ProteinID: NP_001274511
OMIM: 157680
HGNC: 1727
Ensembl: ENSG00000158402
Vega: OTTHUMG00000129203
Pharos: P30307(Tchem)
UniProt: P30307
LinkDB All DBs
Structure
PDB: 

Position
5q31.2
AA seq 473 aa AA seqDB search
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaactcttctcatccacaagagaggaaggaagctctggctcaggacccagt
tttaggtctaatcaaaggaaaatgttaaacctgctcctggagagagacacttcctttacc
gtctgtccagatgtccctagaactccagtgggcaaatttcttggtgattctgcaaaccta
agcattttgtctggaggaaccccaaaacgttgcctcgatctttcgaatcttagcagtggg
gagataactgccactcagcttaccacttctgcagaccttgatgaaactggtcacctggat
tcttcaggacttcaggaagtgcatttagctgggatgaatcatgaccagcacctaatgaaa
tgtagcccagcacagcttctttgtagcactccgaatggtttggaccgtggccatagaaag
agagatgcaatgtgtagttcatctgcaaataaagaaaatgacaatggaaacttggtggac
agtgaaatgaaatatttgggcagtcccattactactgttccaaaattggataaaaatcca
aacctaggagaagaccaggcagaagagatttcagatgaattaatggagttttccctgaaa
gatcaagaagcaaaggtgagcagaagtggcctatatcgctccccgtcgatgccagagaac
ttgaacaggccaagactgaagcaggtggaaaaattcaaggacaacacaataccagataaa
gttaaaaaaaagtatttttctggccaaggaaagctcaggaagggcttatgtttaaagaag
acagtctctctgtgtgacattactatcactcagatgctggaggaagattctaaccagggg
cacctgattggtgatttttccaaggtatgtgcgctgccaaccgtgtcagggaaacaccaa
gatctgaagtatgtcaacccagaaacagtggctgccttactgtcggggaagttccagggt
ctgattgagaagttttatgtcattgattgtcgctatccatatgagtatctgggaggacac
atccagggagccttaaacttatatagtcaggaagaactgtttaacttctttctgaagaag
cccatcgtccctttggacacccagaagagaataatcatcgtgttccactgtgaattctcc
tcagagaggggcccccgaatgtgccgctgtctgcgtgaagaggacaggtctctgaaccag
tatcctgcattgtactacccagagctatatatccttaaaggcggctacagagacttcttt
ccagaatatatggaactgtgtgaaccacagagctactgccctatgcatcatcaggaccac
aagactgagttgctgaggtgtcgaagccagagcaaagtgcaggaaggggagcggcagctg
cgggagcagattgcccttctggtgaaggacatgagcccatga

DBGET integrated database retrieval system