Homo sapiens (human): 998 Entry 998               CDS       T01001                                  Gene name CDC42, CDC42Hs, G25K, TKS Definition (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism hsa  Homo sapiens (human) Pathway hsa04010   MAPK signaling pathway hsa04014   Ras signaling pathway hsa04015   Rap1 signaling pathway hsa04062   Chemokine signaling pathway hsa04144   Endocytosis hsa04360   Axon guidance hsa04370   VEGF signaling pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04530   Tight junction hsa04660   T cell receptor signaling pathway hsa04666   Fc gamma R-mediated phagocytosis hsa04670   Leukocyte transendothelial migration hsa04722   Neurotrophin signaling pathway hsa04810   Regulation of actin cytoskeleton hsa04912   GnRH signaling pathway hsa04932   Non-alcoholic fatty liver disease (NAFLD) hsa04933   AGE-RAGE signaling pathway in diabetic complications hsa05100   Bacterial invasion of epithelial cells hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05130   Pathogenic Escherichia coli infection hsa05131   Shigellosis hsa05132   Salmonella infection hsa05135   Yersinia infection hsa05165   Human papillomavirus infection hsa05200   Pathways in cancer hsa05203   Viral carcinogenesis hsa05205   Proteoglycans in cancer hsa05211   Renal cell carcinoma hsa05212   Pancreatic cancer Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     998 (CDC42)    04015 Rap1 signaling pathway     998 (CDC42)    04010 MAPK signaling pathway     998 (CDC42)    04370 VEGF signaling pathway     998 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     998 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     998 (CDC42)    04520 Adherens junction     998 (CDC42)    04530 Tight junction     998 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     998 (CDC42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     998 (CDC42)    04666 Fc gamma R-mediated phagocytosis     998 (CDC42)    04670 Leukocyte transendothelial migration     998 (CDC42)    04062 Chemokine signaling pathway     998 (CDC42)   09152 Endocrine system    04912 GnRH signaling pathway     998 (CDC42)   09156 Nervous system    04722 Neurotrophin signaling pathway     998 (CDC42)   09158 Development    04360 Axon guidance     998 (CDC42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     998 (CDC42)    05205 Proteoglycans in cancer     998 (CDC42)    05203 Viral carcinogenesis     998 (CDC42)   09162 Cancer: specific types    05212 Pancreatic cancer     998 (CDC42)    05211 Renal cell carcinoma     998 (CDC42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease (NAFLD)     998 (CDC42)    04933 AGE-RAGE signaling pathway in diabetic complications     998 (CDC42)   09171 Infectious disease: bacterial    05120 Epithelial cell signaling in Helicobacter pylori infection     998 (CDC42)    05130 Pathogenic Escherichia coli infection     998 (CDC42)    05132 Salmonella infection     998 (CDC42)    05131 Shigellosis     998 (CDC42)    05135 Yersinia infection     998 (CDC42)    05100 Bacterial invasion of epithelial cells     998 (CDC42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     998 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     998 (CDC42)    03036 Chromosome and associated proteins [BR:hsa03036]     998 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     998 (CDC42)    04031 GTP-binding proteins [BR:hsa04031]     998 (CDC42) Membrane trafficking [BR:hsa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     998 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     998 (CDC42)   Macropinocytosis    Ras GTPases     998 (CDC42) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic Type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     998 (CDC42) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of microglial cells    998 (CDC42)   Exosomal proteins of breast milk    998 (CDC42) GTP-binding proteins [BR:hsa04031]  Small (Monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     998 (CDC42) SSDB Motif Pfam:  Ras Roc Arf PET117 GTP_EFTU Other DBs NCBI-GeneID:  998 NCBI-ProteinID:  NP_001034891 OMIM:  116952 HGNC:  1736 Ensembl:  ENSG00000070831 Vega:  OTTHUMG00000002753 Pharos:  P60953(Tchem) UniProt:  P60953 A0A024RAE4 LinkDB Structure PDB:  4JS0 2NGR 3VHL 1NF3 1GRN 2DFK 2WMO 2WM9 4ITR 3GCG 1KI1 4DID 2WMN 5UPK 2QRZ 2ODB 1KZ7 4YC7 1A4R 5CJP 1KZG 1DOA 3QBV 1AM4 1AN0 5UPL 5FI1 6AJL 6AJ4 5HZK 4YDH 2KB0 2ASE 1GZS 1E0A 1EES 1CF4 1CEE 1AJE Position 1p36.12 AA seq 191 aa MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKSRRCVLL NT seq 576 nt   +upstreamnt  +downstreamnt atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system