Entry |
|
Gene name |
CDC42, CDC42Hs, G25K, TKS
|
Definition |
(RefSeq) cell division cycle 42
|
KO |
K04393 | cell division control protein 42 |
|
Organism |
|
Pathway |
hsa04660 | T cell receptor signaling pathway |
hsa04666 | Fc gamma R-mediated phagocytosis |
hsa04670 | Leukocyte transendothelial migration |
hsa04810 | Regulation of actin cytoskeleton |
hsa04932 | Non-alcoholic fatty liver disease |
hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
hsa05100 | Bacterial invasion of epithelial cells |
hsa05120 | Epithelial cell signaling in Helicobacter pylori infection |
hsa05130 | Pathogenic Escherichia coli infection |
|
Network |
nt06110 MAPK signaling (viruses and bacteria) nt06135 Cytoskeletal regulation (viruses and bacteria) nt06139 NLR signaling (viruses and bacteria) |
Element |
N01070 | ITGA/B-FAK-CDC42 signaling pathway |
N01071 | Shigella IpgB1 to ITGA/B-FAK-CDC42 signaling pathway |
N01076 | Shigella IcsB to ITGA/B-FAK-CDC42 signaling pathway |
N01096 | Escherichia Map to CDC42 signaling pathway |
N01112 | Salmonella SopE/E2 to NOD-NFKB signaling pathway |
N01119 | RAC/CDC42-PAK-ERK signaling pathway |
N01120 | Salmonella SptP to RAC/CDC42-PAK-ERK signaling pathway |
N01134 | Salmonella SopB to CDC42 signaling pathway |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
998 (CDC42)
04014 Ras signaling pathway
998 (CDC42)
04015 Rap1 signaling pathway
998 (CDC42)
04370 VEGF signaling pathway
998 (CDC42)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
998 (CDC42)
09144 Cellular community - eukaryotes
04510 Focal adhesion
998 (CDC42)
04520 Adherens junction
998 (CDC42)
04530 Tight junction
998 (CDC42)
09142 Cell motility
04810 Regulation of actin cytoskeleton
998 (CDC42)
09150 Organismal Systems
09151 Immune system
04660 T cell receptor signaling pathway
998 (CDC42)
04666 Fc gamma R-mediated phagocytosis
998 (CDC42)
04670 Leukocyte transendothelial migration
998 (CDC42)
04062 Chemokine signaling pathway
998 (CDC42)
09152 Endocrine system
04912 GnRH signaling pathway
998 (CDC42)
09156 Nervous system
04722 Neurotrophin signaling pathway
998 (CDC42)
09158 Development and regeneration
04360 Axon guidance
998 (CDC42)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
998 (CDC42)
05205 Proteoglycans in cancer
998 (CDC42)
05203 Viral carcinogenesis
998 (CDC42)
09162 Cancer: specific types
05212 Pancreatic cancer
998 (CDC42)
05211 Renal cell carcinoma
998 (CDC42)
09172 Infectious disease: viral
05165 Human papillomavirus infection
998 (CDC42)
09171 Infectious disease: bacterial
05120 Epithelial cell signaling in Helicobacter pylori infection
998 (CDC42)
05130 Pathogenic Escherichia coli infection
998 (CDC42)
05132 Salmonella infection
998 (CDC42)
05131 Shigellosis
998 (CDC42)
05135 Yersinia infection
998 (CDC42)
05100 Bacterial invasion of epithelial cells
998 (CDC42)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
998 (CDC42)
04933 AGE-RAGE signaling pathway in diabetic complications
998 (CDC42)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:hsa04131]
998 (CDC42)
03036 Chromosome and associated proteins [BR:hsa03036]
998 (CDC42)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
998 (CDC42)
04031 GTP-binding proteins [BR:hsa04031]
998 (CDC42)
Membrane trafficking [BR:hsa04131]
Exocytosis
Small GTPases and associated proteins
Rho GTPases
998 (CDC42)
Endocytosis
Lipid raft mediated endocytosis
GRAF1-dependent endocytosis
998 (CDC42)
Macropinocytosis
Ras GTPases
998 (CDC42)
Chromosome and associated proteins [BR:hsa03036]
Eukaryotic type
Centrosome formation and ciliogenesis proteins
Other centriole associated proteins
998 (CDC42)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of microglial cells
998 (CDC42)
Exosomal proteins of breast milk
998 (CDC42)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
998 (CDC42)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Structure |
PDB: |
Position |
1p36.12
|
AA seq |
191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL |
NT seq |
576 nt +upstreamnt +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga |