KEGG   Homo sapiens (human): 9997Help
Entry
9997              CDS       T01001                                 

Gene name
SCO2, CEMCOX1, ECGF1, Gliostatin, MYP6, PD-ECGF, SCO1L, TP, TYMP, TdRPase
Definition
(RefSeq) SCO cytochrome c oxidase assembly protein 2
  KO
K07152  protein SCO1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05230  Central carbon metabolism in cancer
Disease
H01200  Fatal infantile cardioencephalomyopathy
H01368  Cytochrome c oxidase (COX) deficiency
H02041  Myopia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    9997 (SCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9997 (SCO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    9997 (SCO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCO1-SenC Thioredoxin_8 AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 9997
NCBI-ProteinID: NP_001162580
OMIM: 604272
HGNC: 10604
Ensembl: ENSG00000130489 ENSG00000284194
Vega: OTTHUMG00000191637
Pharos: O43819(Tbio)
UniProt: O43819
LinkDB All DBs
Structure
PDB: 

Position
22q13.33
AA seq 266 aa AA seqDB search
MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTR
LLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR
GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARY
VQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDY
YGRSRSAEQISDSVRRHMAAFRSVLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgactcggagccccacagcttggcacaggctctctcagctcaagcctcgg
gtcctccctgggaccctgggaggccaggccctgcatctgaggtcctggcttttgtcaagg
cagggccctgcagagacaggtgggcagggccagccccagggccctgggcttcgaacccgg
ctgctgatcacaggcctgttcggggctggactcggtggggcctggctggccctgagggct
gagaaggagaggctgcagcagcaaaagcgaacagaagccctgcgccaggcagctgtgggc
cagggcgacttccacctgctggatcacagaggccgggctcgctgcaaggctgacttccgg
ggccagtgggtgctgatgtactttggcttcactcactgccctgacatctgcccagacgag
ctggagaagctggtgcaggtggtgcggcagctggaagcagagcctggtttgcctccagtg
cagcctgtcttcatcactgtggaccccgagcgggacgacgttgaagccatggcccgctac
gtccaggacttccacccaagactgttgggtctgaccggctccaccaaacaggttgcccag
gctagtcacagttaccgcgtgtactacaatgcaggccccaaggatgaggaccaggactac
atcgtggaccactccattgccatctacctgctcaaccctgacggcctcttcacggattac
tacggccggagcagatcggctgagcagatctcagacagtgtgcggcggcacatggcggct
ttccgcagtgtcctgtcttga

DBGET integrated database retrieval system