KEGG   VARIANT: 4005v1Help
Entry
4005v1                      Variant                                

Name
LMO2 rearrangement
Gene
LMO2  LIM domain only 2 [KO:K15612]
Organism
hsa_var Human gene variants (Homo sapiens)
Variation
translocation t(11;14) (p13;q11)
Variation
translocation t(7;11)(q35;p13)
Variation
deletion del(11)(p12p13)
Network
nt06240  Transcription
  Element
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Reference
  Authors
Chambers J, Rabbitts TH
  Title
LMO2 at 25 years: a paradigm of chromosomal translocation proteins.
  Journal
Open Biol 5:150062 (2015)
DOI:10.1098/rsob.150062
Reference
  Authors
Larmonie NS, Dik WA, Meijerink JP, Homminga I, van Dongen JJ, Langerak AW
  Title
Breakpoint sites disclose the role of the V(D)J recombination machinery in the formation of T-cell receptor (TCR) and non-TCR associated aberrations in T-cell acute lymphoblastic leukemia.
  Journal
Haematologica 98:1173-84 (2013)
DOI:10.3324/haematol.2012.082156
Reference
  Authors
Van Vlierberghe P, van Grotel M, Beverloo HB, Lee C, Helgason T, Buijs-Gladdines J, Passier M, van Wering ER, Veerman AJ, Kamps WA, Meijerink JP, Pieters R
  Title
The cryptic chromosomal deletion del(11)(p12p13) as a new activation mechanism of LMO2 in pediatric T-cell acute lymphoblastic leukemia.
  Journal
Blood 108:3520-9 (2006)
DOI:10.1182/blood-2006-04-019927
LinkDB All DBs

KEGG   Homo sapiens (human): 8861Help
Entry
8861              CDS       T01001                                 

Gene name
LDB1, CLIM-2, CLIM2, LDB-1, NLI
Definition
(RefSeq) LIM domain binding 1
  KO
K15617  LIM domain-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8861 (LDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM_bind LID
Motif
Other DBs
NCBI-GeneID: 8861
NCBI-ProteinID: NP_001106878
OMIM: 603451
HGNC: 6532
Ensembl: ENSG00000198728
Vega: OTTHUMG00000018950
Pharos: Q86U70(Tbio)
UniProt: Q86U70
LinkDB All DBs
Structure
PDB: 

Position
10q24.32
AA seq 411 aa AA seqDB search
MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRH
TPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIG
RTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEG
RLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTL
NYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITR
LENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgggctgtgcctgtcctggttgttcctcaaagtcattcaagctgtactcgccg
aaggagcccccgaacggcaacgcctttccccccttccatcccggcaccatgctggatagg
gatgtgggcccaactcccatgtatccgcctacatacctggagccagggattgggaggcac
acaccatatggcaaccaaactgactacagaatatttgagcttaacaaacggcttcagaac
tggacagaggagtgtgacaatctctggtgggatgcattcacgactgagttctttgaggat
gatgccatgttgaccatcactttctgcctggaggatggaccaaagagatataccattggc
cggaccctgatcccacgctacttccgcagcatctttgaggggggtgctacggagctgtac
tatgttcttaagcaccccaaggaggcattccacagcaactttgtgtccctcgactgtgac
cagggcagcatggtgacccagcatggcaagcccatgttcacccaggtgtgtgtggagggc
cggttgtacctggagttcatgtttgacgacatgatgcggataaagacgtggcacttcagc
atccggcagcaccgagagctcatcccccgcagcatccttgccatgcatgcccaagacccc
cagatgttggatcagctctccaaaaacatcactcggtgtgggctgtccaattccactctc
aactacctccgactctgtgtgatactcgagcccatgcaagagctcatgtcacgccacaag
acctacagcctcagcccccgcgactgcctcaagacctgccttttccagaagtggcagcgc
atggtagcaccccctgcggagcccacacgtcagcagcccagcaaacggcggaaacggaag
atgtcagggggcagcaccatgagctctggtggtggcaacaccaacaacagcaacagcaag
aagaagagcccagctagcaccttcgccctctccagccaggtacctgatgtgatggtggtg
ggggagcccaccctgatgggcggggagttcggggacgaggacgagaggctcatcacccgg
ctggagaacacccagtttgacgcagccaacggcattgacgacgaggacagctttaacaac
tcccctgcactgggcgccaacagcccctggaacagcaagcctccgtccagccaagaaagc
aaatcggagaaccccacgtcacaggcctcccagtaa

DBGET integrated database retrieval system