KEGG   VARIANT: 7428v2Help
Entry
7428v2                      Variant                                

Name
VHL mutation
Gene
VHL  von Hippel-Lindau tumor suppressor [KO:K03871]
Organism
hsa_var Human gene variants (Homo sapiens)
Variation
mutation R167Q
ClinVar: 2216
dbSNP: rs5030821
COSM: 17983
Variation
mutation C162F
ClinVar: 43604
dbSNP: rs397516444
COSM: 25676
Variation
mutation N78S
ClinVar: 93326
dbSNP: rs5030804
COSM: 17855 5006570
Variation
mutation Y98H
ClinVar: 2223
dbSNP: rs5030809
Variation
mutation D121Y
COSM: 34019
Variation
mutation V130F
COSM: 97148
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Reference
  Authors
Couve S, Ladroue C, Laine E, Mahtouk K, Guegan J, Gad S, Le Jeune H, Le Gentil M, Nuel G, Kim WY, Lecomte B, Pages JC, Collin C, Lasne F, Benusiglio PR, Bressac-de Paillerets B, Feunteun J, Lazar V, Gimenez-Roqueplo AP, Mazure NM, Dessen P, Tchertanov L, Mole DR, Kaelin W, Ratcliffe P, Richard S, Gardie B
  Title
Genetic evidence of a precisely tuned dysregulation in the hypoxia signaling pathway during oncogenesis.
  Journal
Cancer Res 74:6554-64 (2014)
DOI:10.1158/0008-5472.CAN-14-1161
Reference
  Authors
Rechsteiner MP, von Teichman A, Nowicka A, Sulser T, Schraml P, Moch H
  Title
VHL gene mutations and their effects on hypoxia inducible factor HIFalpha: identification of potential driver and passenger mutations.
  Journal
Cancer Res 71:5500-11 (2011)
DOI:10.1158/0008-5472.CAN-11-0757
Reference
  Authors
Arjumand W, Sultana S
  Title
Role of VHL gene mutation in human renal cell carcinoma.
  Journal
Tumour Biol 33:9-16 (2012)
DOI:10.1007/s13277-011-0257-3
LinkDB All DBs

KEGG   Homo sapiens (human): 9978Help
Entry
9978              CDS       T01001                                 

Gene name
RBX1, BA554C12.1, RNF75, ROC1
Definition
(RefSeq) ring-box 1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04066  HIF-1 signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05131  Shigellosis
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06123  TNF signaling (viruses and bacteria)
nt06130  Cell cycle (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06225  HIF-1 signaling
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06264  Renal cell carcinoma
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00942  Shigella OspG to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9978 (RBX1)
   04120 Ubiquitin mediated proteolysis
    9978 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    9978 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    9978 (RBX1)
   04350 TGF-beta signaling pathway
    9978 (RBX1)
   04066 HIF-1 signaling pathway
    9978 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9978 (RBX1)
   04114 Oocyte meiosis
    9978 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    9978 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9978 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    9978 (RBX1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    9978 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9978 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9978 (RBX1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9978 (RBX1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     9978 (RBX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   9978 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     9978 (RBX1)
   ECV complex
     9978 (RBX1)
   Cul3 complex
     9978 (RBX1)
   Cul4 complex
     9978 (RBX1)
   Cul7 complex
     9978 (RBX1)
   Cul9 complex
     9978 (RBX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      9978 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      9978 (RBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 9978
NCBI-ProteinID: NP_055063
OMIM: 603814
HGNC: 9928
Ensembl: ENSG00000100387
Vega: OTTHUMG00000151298
Pharos: P62877(Tbio)
UniProt: P62877
LinkDB All DBs
Structure
PDB: 

Position
22q13.2
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtatgggcactag

KEGG   Homo sapiens (human): 6921Help
Entry
6921              CDS       T01001                                 

Gene name
ELOC, SIII, TCEB1
Definition
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6921 (ELOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6921 (ELOC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6921 (ELOC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    6921 (ELOC)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6921 (ELOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6921 (ELOC)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6921 (ELOC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     6921 (ELOC)
   ECS complex
     6921 (ELOC)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     6921 (ELOC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ PTAC
Motif
Other DBs
NCBI-GeneID: 6921
NCBI-ProteinID: NP_001191786
OMIM: 600788
HGNC: 11617
Ensembl: ENSG00000154582
Vega: OTTHUMG00000164501
Pharos: Q15369(Tbio)
UniProt: Q15369 A0A024R7Y5
LinkDB All DBs
Structure
PDB: 

Position
8q21.11
AA seq 112 aa AA seqDB search
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggacctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acgataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcgaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcgaacttcttagattgttaa

KEGG   Homo sapiens (human): 6923Help
Entry
6923              CDS       T01001                                 

Gene name
ELOB, SIII, TCEB2
Definition
(RefSeq) elongin B
  KO
K03873  elongin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6923 (ELOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6923 (ELOB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6923 (ELOB)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    6923 (ELOB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6923 (ELOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6923 (ELOB)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6923 (ELOB)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     6923 (ELOB)
   ECS complex
     6923 (ELOB)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     6923 (ELOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 6923
NCBI-ProteinID: NP_009039
OMIM: 600787
HGNC: 11619
Ensembl: ENSG00000103363
Vega: OTTHUMG00000154125
Pharos: Q15370(Tbio)
UniProt: Q15370
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 118 aa AA seqDB search
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag
tccagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggcctcctgac
gagcagcggctgtacaaggatgaccaactcttggatgatggcaagacactgggcgagtgt
ggcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg
gcagatgacacctttgaggccctgtgcatcgagccgttttccagcccgccagagctgccc
gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

KEGG   Homo sapiens (human): 8453Help
Entry
8453              CDS       T01001                                 

Gene name
CUL2
Definition
(RefSeq) cullin 2
  KO
K03870  cullin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8453 (CUL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    8453 (CUL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8453 (CUL2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    8453 (CUL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8453 (CUL2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     8453 (CUL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N TFIIE_alpha
Motif
Other DBs
NCBI-GeneID: 8453
NCBI-ProteinID: NP_001185706
OMIM: 603135
HGNC: 2552
Ensembl: ENSG00000108094
Vega: OTTHUMG00000017950
Pharos: Q13617(Tbio)
UniProt: Q13617 A0A140VKB1
LinkDB All DBs
Structure
PDB: 

Position
10p11.21
AA seq 745 aa AA seqDB search
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaaccaagagtagtagattttgatgaaacatggaacaaacttttgacgaca
ataaaagccgtggtcatgttggaatacgtcgaaagagcaacatggaatgaccgtttctca
gatatctatgctttatgtgtggcctatcctgaaccccttggagaaagactttatacagaa
actaagatttttttggaaaatcatgttcggcatttgcataagagagttttggagtcagaa
gaacaagtacttgttatgtatcataggtactgggaagaatacagcaagggtgcagactat
atggactgcttatataggtatctcaacacccagtttattaaaaagaataaattaacagaa
gcggaccttcagtatggctatggtggtgtagatatgaatgaaccacttatggaaatagga
gagctagcattggatatgtggaggaaattgatggttgaaccacttcaggccatccttatc
cgaatgctgctccgagaaatcaaaaatgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcaggaaatttttgagtctccctttctgactgaaacaggagagtattacaaa
caagaagcttcaaatttattacaagaatcaaactgctcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattcgatgtcgaaaatacctacatccaagttcatatact
aaggtgattcatgaatgtcaacaacgaatggtagcagaccacttacagtttttacatgca
gaatgtcataatataattcgacaagagaaaaaaaatgacatggcaaatatgtacgtctta
ctccgtgctgtgtccactggtttacctcatatgattcaggagctgcaaaaccacatccat
gatgagggccttcgagcaaccagcaaccttactcaggaaaacatgccaacactatttgtg
gagtcagttttggaagtgcatggtaaatttgttcagcttatcaacactgttttgaatggt
gatcagcattttatgagtgcgttggataaggcccttacgtcagttgtaaattacagagaa
cctaagtctgtttgcaaagcacctgaactgcttgctaagtactgtgacaacttactgaag
aagtcagcgaaagggatgacagagaatgaagtggaagacaggctcacgagcttcatcaca
gtgttcaaatacattgatgacaaggacgtctttcaaaagttctacgcaagaatgctggca
aaacgtttaattcatgggttatccatgtctatggactctgaagaagccatgatcaacaaa
ttaaagcaagcctgtggttatgagtttaccagcaagctacatcggatgtatacagatatg
agtgtcagcgctgatctcaacaataagttcaacaattttatcaaaaaccaagacacagta
atagatttgggaattagttttcaaatatatgttctacaggctggtgcgtggcctcttact
caggctccttcatctacgtttgcaattccccaggaattagaaaaaagtgtacagatgttt
gaattattttatagccaacatttcagtggaaggaaacttacatggttacattatctgtgt
acaggtgaagttaaaatgaactatttgggcaaaccatatgtagccatggttacaacatac
caaatggcagttcttcttgcctttaacaacagtgaaactgtcagttataaagagcttcag
gacagcactcagatgaatgaaaaggaactgacaaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagatattgatgcagaatcttcgttttcatta
aatatgaactttagcagtaaaagaacaaaatttaaaattactacatcaatgcagaaagac
acaccacaagaaatggagcagactagaagtgcagttgatgaggaccggaaaatgtatctc
caagctgctatagttcgtatcatgaaagcacgaaaagtgcttcggcacaatgcccttatt
caagaggtgattagccagtcaagagctaggtttaatcccagtatcagcatgattaagaag
tgtattgaagttctgatagacaaacaatacatagaacgcagccaggcgtcggcagatgaa
tacagctacgtcgcgtga

DBGET integrated database retrieval system