KEGG   Hungateiclostridium saccincola: HVS_00120Help
Entry
HVS_00120         CDS       T05223                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hsc  Hungateiclostridium saccincola
Pathway
hsc00010  Glycolysis / Gluconeogenesis
hsc00020  Citrate cycle (TCA cycle)
hsc00620  Pyruvate metabolism
hsc00640  Propanoate metabolism
hsc00650  Butanoate metabolism
hsc00680  Methane metabolism
hsc01100  Metabolic pathways
hsc01110  Biosynthesis of secondary metabolites
hsc01120  Microbial metabolism in diverse environments
hsc01130  Biosynthesis of antibiotics
hsc01200  Carbon metabolism
Module
hsc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVS_00120 (porA)
   00020 Citrate cycle (TCA cycle)
    HVS_00120 (porA)
   00620 Pyruvate metabolism
    HVS_00120 (porA)
   00640 Propanoate metabolism
    HVS_00120 (porA)
   00650 Butanoate metabolism
    HVS_00120 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    HVS_00120 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HVS_00120 (porA)
Enzymes [BR:hsc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HVS_00120 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AUG56014
UniProt: A0A2K9E7U4
LinkDB All DBs
Position
18849..20033
Genome map
AA seq 394 aa AA seqDB search
MAIRERLSGNEAVAVAMKQINPDVVAAFPITPSTEIPQYFSNYVADGIVDTEFVAVESEH
SAMSACVGAQAAGGRAMTATSANGLALMWEILYVAACSRLPIVMACVNRTMSGPLNIHND
HSDSMGARDSGWIQLYSENNQEAYDNMLMANRIGEHPDVMLPVMVCQDGFITSHAIENIE
LLEDEKVKEFVGEYNPKLHLLDKDNPISVGPLDLQAYTFEHKRQQAEAMRNAKRVVQEVS
EEFYKLTGRKYGLFEEYKTEDAEVVTVILNSTAGTAKYVVDELRKEGKKVGLIKPRLYRP
FPVDEIANALSKFKAVGVLDKSDSFNGAGGPLFTDVTSALYAKGVFTPKVVNYIYGLGGR
DVRTDDIEFVYNKILEIAATGKVDSVYNYLGVRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctataagagagagattgagcggtaatgaagcggttgcagttgcaatgaaacagata
aatccggatgtagttgcagcttttcctataacaccttcaacggaaatcccgcaatacttt
tccaactatgttgcagatggcattgttgatacagagtttgttgccgttgagtctgaacac
agtgctatgtcagcatgtgtgggtgcacaggcagcgggtggaagagcaatgactgccact
tctgcaaacggtcttgcacttatgtgggaaattctttatgttgcagcatgttcaaggctt
cccatagttatggcttgtgttaacaggaccatgtcaggacctttaaatatccacaatgac
cacagcgattcaatgggggcaagggattcaggatggatacagctctattctgaaaacaac
caggaagcatatgacaatatgcttatggcaaacagaataggagagcatccggatgtaatg
ctgcctgttatggtgtgtcaggacggttttattacatcccatgccatagagaatatagaa
ctccttgaagatgaaaaagttaaagaatttgttggagaatacaatcctaagttacattta
ttggacaaggataatcctatttcagtaggtccattggatttacaggcatatacatttgaa
cataagagacagcaggcggaggcaatgaggaatgctaaaagggttgtacaggaagtttca
gaagaattttacaaattaaccggaagaaagtatggattgtttgaagaatataaaactgaa
gatgctgaagttgttactgtaattttaaactccacagccggtacggcaaaatatgttgtg
gatgagttaagaaaagagggtaaaaaagtaggattgattaaaccaagactatacagacct
ttcccagttgatgaaatagcaaatgcactgtcaaagtttaaagctgttggtgttttagac
aagtctgacagctttaacggagcgggaggacctttatttactgatgtaacaagtgcattg
tatgcaaaaggcgtttttacacctaaagttgtaaactacatatatggtttaggtggaaga
gatgtcagaacggatgatattgaatttgtatacaacaaaattttagaaatagctgccaca
ggtaaagtggattctgtttacaattacctaggtgtcagggaatag

DBGET integrated database retrieval system