KEGG   Herbivorax saccincola: HVS_12515Help
Entry
HVS_12515         CDS       T05223                                 

Gene name
malP
Definition
(GenBank) Maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hsc  Herbivorax saccincola
Pathway
hsc00500  Starch and sucrose metabolism
hsc01100  Metabolic pathways
hsc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HVS_12515 (malP)
Enzymes [BR:hsc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     HVS_12515 (malP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase VirDNA-topo-I_N Pox_TAA1
Motif
Other DBs
NCBI-ProteinID: AUG58376
UniProt: A0A2K9E9Q9
LinkDB All DBs
Position
2743696..2746263
Genome map
AA seq 855 aa AA seqDB search
MYLFGKITVTAVIPEELSKLKDIAYNLWWSWNSDAIDLYREIDLALWEKLGKNPVRFLKE
VSQKKLEAKVNDPDFMSRYRKVVEKYEAYMNETDTWFSRNFPDKKDHMVAYFSAEYGLNE
VLPVYSGGLGVLSGDHCKSASDLGIPFTAIGLFYKQGYFHQHINADGWQETIFTDLNTSN
LPIRPVLDQNGNKVTIEVELPGRIVFAKVWYVQIGRVKLYLMDTDHEHNNESDRALTARL
YGGDQETRIQQEIFLGIGGSRVLDALGIKPTVYHMNEGHSAFLGLELIRKLVQEKNLPFN
EAREVVTSSVVFTTHTPVPAGNDVFPLEMIDKYFSHYWPSLGISRHEFLDLGLKIGDHQN
FNMTVLALNLSGQRNGVSELHGAVSRNIFKNVWPGIPEDEIPIGHITNGIHTLTWLSPTI
KYLYDKYLDSDWYERLYDQSVWDKVDDIPAEELWKSHCVLKTKMIGYVREKLKEQRIANN
ESIEKIKEVDTLLDSNALTIGFARRFATYKRANLIFRDLARIQKILNDPERPVQIIFAGK
AHPADAPAHEIIKHINDIAKQEGFYGKVVLVENYNMTLARNLVQGVDVWLNNPRRPLEAS
GTSGQKVCINGIINFSVLDGWWCEGYNGKNGWAIGDETFYDNEYHQDNADSESIYEILEK
QIIPAFYERNEKGIPEKWVEIMKESIKSAASLFSTHRMVQDYTNMYYVPLMERVDRLTSN
NFKLATDLSNWKKHISREWPQVDIIPDKQITQLNNKNFISGEAIPIYASVKLGNIEPSSV
KVQICYGNVTNGNKIENPHIVDMQLEEKISDNTYSYSTNITLFEGGEYGYTFRVIPNHPD
LINQFDLPLIRWAIQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtatctatttggaaaaattactgtaactgctgttatccccgaagaactatctaaacta
aaagacattgcttataacttgtggtggtcttggaattctgatgccatagacctctacagg
gaaattgaccttgctctttgggaaaaactcgggaaaaacccagtcaggtttctcaaagag
gttagtcaaaaaaaattagaagcaaaagtcaatgatccggattttatgagtaggtacaga
aaggtagtcgaaaagtatgaagcctacatgaatgaaaccgatacatggtttagcaggaac
tttccagataaaaaggatcacatggttgcatacttttctgctgaatatggtttaaatgaa
gtccttcctgtttactcaggcggtctgggagttttatcaggagaccactgtaagtctgcc
agcgacctgggaataccttttactgcaataggacttttttataaacaaggttactttcac
cagcatattaatgcagacgggtggcaagagacaatatttaccgacctgaatacgtctaat
ttgcctataagaccggttttagaccagaatggtaataaggttaccatagaggtggaactt
cctggacgtatagtttttgctaaagtatggtatgtgcaaattggtcgggtgaaactatac
ttaatggatacagatcatgaacacaataatgaaagtgacagagcactcactgcaagatta
tatggtggagaccaggaaaccaggattcagcaggaaattttccttggcatcggaggctcc
agggttcttgatgccttaggaatcaaacctactgtttaccacatgaatgaaggtcattca
gctttcttaggtcttgaactaatcagaaagcttgtgcaggagaaaaatcttccatttaat
gaggccagggaagttgtaacatcatcagttgtattcaccactcatacacctgtacctgcc
ggaaacgacgtcttcccattggagatgattgacaaatatttcagccattactggccttct
ttaggaataagcagacatgagtttttagacttaggattgaaaattggggatcatcaaaac
tttaatatgactgttttagccctaaatctttcaggtcaaagaaacggggttagtgaactt
cacggggctgtatcccgtaacatattcaaaaatgtatggccgggaattcctgaagatgaa
attcctattggtcacattaccaatggtattcatactcttacctggctgtctcccacaatt
aagtatttatacgataaatacttagacagcgactggtatgaaagactttatgatcaaagt
gtgtgggataaagttgatgatattcctgcagaagaattgtggaaatcccattgtgtactg
aaaacaaaaatgattggatatgtacgtgaaaaactaaaggaacaaagaatagccaataat
gaatccatagaaaaaatcaaggaagttgatactctcctggattctaatgccctgaccatc
ggatttgccagaaggtttgcaacttataagagggcaaacttaatattcagggatttggca
aggattcaaaaaatacttaatgaccctgaaagacctgttcaaattatatttgccggaaaa
gcacaccctgctgatgcaccagcacatgagataatcaaacatattaatgacattgcaaaa
caagaaggcttctatggaaaagttgttttagttgaaaactataatatgacacttgcccgc
aatttagtacagggagttgatgtgtggctaaataacccgcgcagacctttagaagctagt
ggaacaagtggtcagaaagtttgtataaacggaattattaatttcagcgttttagacggc
tggtggtgtgaaggatacaacggtaaaaatggttgggctattggagatgaaaccttctac
gacaatgaataccaccaggataatgcagatagtgaatcaatttatgagatacttgaaaaa
caaataattcctgccttctatgagagaaatgaaaaaggtatacctgagaaatgggttgaa
attatgaaggaatcgataaaatcagctgcaagtttatttagcactcatagaatggttcaa
gactacacaaatatgtactatgttcctttaatggaaagagttgatagactgacttcaaat
aactttaagcttgcaactgatttatccaactggaaaaagcatatttcaagagaatggcct
caggtggatattatccctgataagcaaataacccagctaaacaacaaaaactttatatca
ggggaagcaatacctatatacgcatcagttaagcttggaaatattgaaccatcaagtgtt
aaagttcaaatttgctatggaaatgtaaccaacggcaataaaatagaaaatccacatata
gttgatatgcaattggaagaaaaaatatccgacaatacttacagttatagtacaaatata
accctttttgaaggcggagaatatggttataccttcagggtaattccaaatcaccctgat
ttaataaatcagtttgatttgcctttaattagatgggcaatacaataa

DBGET integrated database retrieval system