KEGG   Hungateiclostridium saccincola: HVS_14240Help
Entry
HVS_14240         CDS       T05223                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hsc  Hungateiclostridium saccincola
Pathway
hsc00473  D-Alanine metabolism
hsc01100  Metabolic pathways
hsc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HVS_14240 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HVS_14240 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsc01011]
    HVS_14240 (alr)
Enzymes [BR:hsc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HVS_14240 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:hsc01011]
 Precursor biosynthesis
  Racemase
   HVS_14240 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Peptidase_C23
Motif
Other DBs
NCBI-ProteinID: AUG58709
UniProt: A0A2K9E5S1
LinkDB All DBs
Position
complement(3141958..3143127)
Genome map
AA seq 389 aa AA seqDB search
MEYKFNRAWAEVNLDNIAHNVREIRKIVDKKTEILGVVKADAYGHGVMEVAKVLLENGVS
RLAVSMLDEAIQLRKNGIEVPILVLSYTDPGRAEEIIENDVTQTVFSHDLAESLSQAAQR
LRKNIKIHIKIDTGMTRVGFMPGYSAVKNVISISKLPRIIVEGLFTHFASADEKDKTYTN
MQFERFTTIINELNRVGVYIPVKHVCNSAGIIEFPHMHLNMVRPGIALYGLYPSSDVDRE
KINLKPAMTLKANIILVKEVEKDTSVSYGRIFKTNRESKIATIPIGYADGYTRLLTNKGE
VLVNGQRAPIVGKICMDQCMVDITDIKGDVNVGDEVVLFGKQGEGEIKVEELAQSIGTIN
YEVVSIIGKRIPRVYFKNGKVHNVLNYLI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaaatttaacagggcgtgggcagaggtaaaccttgataatattgcccacaat
gtacgggaaataagaaaaatagttgataaaaaaactgaaatactaggggttgtaaaggct
gatgcctatggtcacggggtaatggaagtggcaaaggttcttctagagaacggggttagc
cgtttagcggtttccatgcttgatgaagcaatacagcttaggaaaaacggaattgaggtg
ccgattctggtattaagctacacagaccccggcagggcggaagaaataattgaaaatgat
gtaacccagacggtattcagtcacgatttggcggagagcttgtctcaagctgcccaaaga
cttagaaagaatataaagattcatataaagattgatacaggtatgacaagagtggggttt
atgcctggctacagtgctgttaaaaatgttatttcaataagtaagcttccccgcataatt
gtagaggggctgtttacgcattttgcttcagcagatgaaaaggataaaacgtatacaaat
atgcagtttgaaagatttaccaccataataaatgaactgaacagggtaggagtgtatatc
cctgtaaagcatgtgtgcaacagcgcaggaataattgaatttccccatatgcatcttaac
atggtaaggccgggaattgctttatacggcttatacccgtcttcagatgtggacagggaa
aaaataaatttgaaacctgccatgacgttaaaagccaacataatacttgtaaaagaggta
gaaaaagacacttctgtaagctatggcaggatatttaaaacaaacagggaaagtaaaatt
gcaaccattcccataggttatgccgacggctacacgaggcttttgacaaacaaaggggaa
gtgctggtaaacggacagagggcaccaatagtgggcaaaatctgtatggaccagtgtatg
gtggatataactgatataaaaggagatgtaaatgtaggtgacgaagtggttctctttgga
aagcagggagaaggagaaataaaagttgaggagttggcccaaagtattggtacaataaat
tatgaagtggtaagcattataggaaaaagaataccaagggtgtattttaaaaacggtaaa
gtacacaatgttctaaattatttaatttaa

DBGET integrated database retrieval system