KEGG   Hungateiclostridium saccincola: HVS_14535Help
Entry
HVS_14535         CDS       T05223                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
hsc  Hungateiclostridium saccincola
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsc03110]
    HVS_14535 (hslO)
Chaperones and folding catalysts [BR:hsc03110]
 Heat shock proteins
  HSP33
   HVS_14535 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AUG58760
UniProt: A0A2K9ET88
LinkDB All DBs
Position
complement(3196916..3197794)
Genome map
AA seq 292 aa AA seqDB search
MKDYLVRATAEEGKVRTVAAVTTNLVKHAQKIHGLSPLASVALGRTLTAGVLMSVFLKSP
KNTQTIQIKGDGPLGGIVVVSDSEANVRGYVHNPLVYLPLNSEGKFDVAGAIGKGYLNVI
KDLGLKEPYVGYVDLISGEIAEDIAYYYAYSEQIPTIVALGVLTSADKIIETAGGFIIQL
MPDAGEETINFLEEKIKNLSSVTGLLKDGKTPEDILDMIFSERNLKIGEKAPCNYKCNCS
RERMYRNIISLGKEEIKNILKEQSEIEAQCHFCDMKYQFQESDLREIIGEES
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattatcttgtaagggcgactgcagaagaaggaaaagtaaggacagttgcagca
gtgactaccaatttggtaaagcatgcccagaaaattcatggactttcccccctggcatct
gttgcgttagggcgaactcttactgccggggttttaatgtcggtatttttaaagtcgcct
aaaaacacacagacaatacaaattaaaggtgacggacctttaggcgggattgttgtggtt
tctgattctgaggcaaatgtaaggggatatgtgcataatccattggtataccttccttta
aacagtgaaggaaaatttgacgtagcaggagccattggcaaaggctatttaaatgtgatt
aaggatttggggctaaaagagccttatgtaggttatgtggacctgatatcaggagaaatt
gctgaagatatagcatactattatgcctattcagaacaaattcctacaattgtagcttta
ggtgttctgaccagtgcagataaaattatagaaacagcaggaggatttattatccagtta
atgcctgatgctggtgaggagaccatcaactttcttgaagaaaaaatcaaaaacctgtct
tcagttacaggcttattgaaagatggtaaaaccccggaagatatacttgatatgatattt
tctgaaaggaacttaaaaatcggggaaaaagcaccttgcaattataaatgcaactgttca
agggagcgtatgtatagaaatataatcagtcttggaaaagaagaaataaagaatatatta
aaggaacaaagtgaaatagaggcacagtgccatttttgtgatatgaaatatcagtttcag
gagtcagatttaagggaaataattggagaggaaagttaa

DBGET integrated database retrieval system