KEGG   Herbinix luporum: SD1D_0096Help
Entry
SD1D_0096         CDS       T04072                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hsd  Herbinix luporum
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SD1D_0096 (ahpF)
Enzymes [BR:hsd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SD1D_0096 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 Thioredoxin_3 DAO FAD_binding_3 FAD_oxidored AlaDh_PNT_C NAD_binding_7 Thi4 K_oxygenase Glutaredoxin Xrn1_D3 NAD_binding_8 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CUH91658
UniProt: A0A0K8J2Y5
LinkDB All DBs
Position
I:94351..95880
Genome map
AA seq 509 aa AA seqDB search
MILDTEIKNQLAEYLKLLEGDVLIKVSVGDDSVSKDIISLVEELALLSPKIKTEEAKLPR
TPSFSINRTDKDMGITFAGLPLGHEFTSLVLALLQVSGRPPKVEEHVAKQVKKLKGEFHF
ETYISLSCHNCPEVVQALNIMSVLNPNVTHTMIDGAAFKDEVESKDIMAVPAIYLNGEFF
GGGRMTLEEILAKLDVTPDASLFEDKEPFDVLVIGGGPAGASAAIYAARKGIRTGIVAQR
FGGQVRDTMAIENFISVKQTEGPKLAAALEDHVREYDVDIMCPQRVKSIEKKDIFLIELE
NGAILKSKTVIIATGARWRNVNVPGEAEFKNKGVAYCPHCDGPLYKGKRVAVIGGGNSGI
EAAIDLAGVVDHVTVMEFMPELKADLVLQERLYSLPNVTVLKNVQTKEITGDSKVNGITY
VERDTGIEKHIDLEGVFVQIGLVPNTEWLEDFLERNPMGEIPVDKYNATKIPGLFAAGDC
TDSPNKQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatacagaaattaaaaatcaactggcggagtatctgaagctgttagagggc
gacgttttaattaaagtcagtgtaggagacgattctgtatccaaggatattatttctctg
gtagaggagcttgctttactgtcacctaagattaagacagaagaagcaaagcttcctcgt
acacctagctttagtataaaccgtactgataaggatatgggtattacctttgccggtctt
cccttaggccatgaatttacttctttagtattggcacttctacaagttagcggaagacct
ccaaaggtagaggaacatgtggccaagcaggttaagaagctgaagggtgaatttcatttt
gagacctatatcagtttaagctgccataattgtccggaagtcgttcaagccctaaatatt
atgagtgttctaaatcctaatgttacccatactatgatagacggagctgcctttaaggat
gaggtagaaagcaaggatattatggctgtgcctgccatatacctaaatggtgagttcttt
gggggaggacgtatgactttagaagaaattctagcaaagctagacgtcacccctgatgcc
tctttgtttgaagataaagaaccctttgatgttttggttatcggaggcggtcctgcggga
gccagtgcagccatatatgcagctagaaagggaataagaactggtatagttgcccagcgg
tttggtggacaggtaagggacaccatggctatagagaattttatcagtgttaagcaaaca
gagggtcctaagctggcagcagctctagaagatcatgtcagagagtatgatgtagatata
atgtgcccccaaagggtaaaaagcatcgaaaagaaagatatcttcttaattgagttggaa
aatggagccattctaaaaagtaaaaccgtaattattgctaccggagcccgttggagaaat
gtaaatgttccaggggaggctgaatttaagaataaaggtgtggcctattgtcctcactgt
gacggtcctttgtataaaggaaaaagggtagcagttataggtggaggcaattcaggtata
gaggccgccatagacctagccggagtggtagatcatgttacggtaatggaatttatgccg
gagctaaaagctgatttggttttacaagagcggttatatagtctgcctaatgtaacagta
ttaaaaaatgtccagactaaagaaattaccggggacagcaaggttaatggtataacttat
gtggaaagggataccggtatagaaaagcatatagaccttgaaggtgtctttgttcaaata
ggtcttgtacctaatacagagtggctggaagatttccttgaaagaaatcctatgggtgaa
atacctgtagataaatataacgccactaaaattcccggattgtttgctgcaggagactgc
accgacagccctaacaaacagataataatatctatgggatccggagcaaatgcagcttta
ggggcatttgactatttgattagaaattag

DBGET integrated database retrieval system