KEGG   Herbinix luporum: SD1D_0246Help
Entry
SD1D_0246         CDS       T04072                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hsd  Herbinix luporum
Pathway
hsd00473  D-Alanine metabolism
hsd00550  Peptidoglycan biosynthesis
hsd01100  Metabolic pathways
hsd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SD1D_0246 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SD1D_0246 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SD1D_0246 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsd01011]
    SD1D_0246 (ddl)
Enzymes [BR:hsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SD1D_0246 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hsd01011]
 Precursor biosynthesis
  Amino acid ligase
   SD1D_0246 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK GARS_A ATP-grasp Toxin_31 ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: CUH91799
UniProt: A0A0K8J363
LinkDB All DBs
Position
I:complement(251748..252779)
Genome map
AA seq 343 aa AA seqDB search
MKIVVLAGGTSPERDVSLSTGKMIYKALKNKGHQTILLDVYLGYEGDTSNLFDIEKDWAE
GIGNIGTYNPDIKEIKALRKGNPDHFFGPGVLEICDMADIVFLALHGENGEDGRIQAAFD
LMGIKYTGTDYASSTIAMDKAVSKELFTYYNIPSPKGIYVRKGEEYTWDSFPCVVKVNNG
GSSVGVSIVHSADEMDAAIDNALSYGDQLIIEQYIKGREFSVGVIDGKALPVIEIAPISG
FYDYKNKYQAGNAIETCPADLDEAISKQMQDFAVMVFKALRLKTYARMDFLLNDKNEIYC
LEANTLPGMTPTSLLPQEAKAIGIDFEDLCELIIDISLKKYNK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagtagtattagcagggggaaccagtcccgaacgagatgtatctctttctaca
ggaaagatgatttataaagctttaaaaaataagggacaccaaaccatactattagatgta
tatttaggttacgaaggagatacaagtaatctatttgatatagaaaaagactgggccgaa
ggaatcggcaatatcggtacctataatccagatataaaggaaattaaagccctaagaaaa
ggcaatccagatcacttcttcggaccgggggtactggaaatatgcgacatggcagatatc
gtatttttagcactccacggggaaaacggtgaagacggcagaatccaggctgcctttgac
ctaatgggtattaaatataccggtaccgattatgccagcagtaccattgctatggataag
gctgtctccaaagaactgtttacatattataatatccctagtcctaaaggtatctatgtt
agaaagggagaagaatatacttgggatagctttccttgcgttgttaaggtaaataatggt
ggttccagtgtaggtgtatccattgtgcattcagctgatgaaatggatgctgccattgat
aatgccctatcctatggggaccaacttattatagaacaatatattaaaggtagggagttt
tctgtaggagtaattgacggaaaggctttacctgttattgagattgcccctatttcaggt
ttttacgattataaaaataaatatcaggcaggcaatgccattgaaacatgtcctgctgac
cttgatgaggccatatcaaaacagatgcaggattttgcagtaatggtatttaaggctctt
cgcctaaaaacctatgcccgaatggactttttattaaatgataaaaatgaaatctactgc
ctagaagcaaatacccttcccggtatgacccctacatccttacttccccaagaggccaag
gctataggaatagattttgaagatttatgcgaattaataatagatatttccttgaaaaaa
tataataaataa

DBGET integrated database retrieval system