KEGG   Herbinix luporum: SD1D_0806Help
Entry
SD1D_0806         CDS       T04072                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsd  Herbinix luporum
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsd01001]
    SD1D_0806
Enzymes [BR:hsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SD1D_0806
Protein kinases [BR:hsd01001]
 Serine/threonine kinases: Other
  Bacterial family
   SD1D_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Orf78 Pkinase_fungal Kdo DUF4834 DUF4064 ABC2_membrane_3 KIND CD20 DUF1189
Motif
Other DBs
NCBI-ProteinID: CUH92354
UniProt: A0A0K8J4T0
LinkDB All DBs
Position
I:872232..874394
Genome map
AA seq 720 aa AA seqDB search
MLKPGMFISDRYEIIDSVGSGGMADVYKAKDHRLNRFVAIKVLKPEYSSDKSFVNKFRGE
AQSAAGLSHPNIVNVYDVGDDGGLYYIVMELVEGITLKRFIERKGKLDVKEAVGIAIQIA
QGLEAAHDNNIIHRDIKPQNIIISRDGKVKVTDFGIAKASNSNTITSNAMGSVHYLSPEQ
ARGGYSDEKSDIYSLGVTLYEMLSGKVPFVGDNNVSVALLHIQGEAAPLRELEEDIPLSV
DKIVQKCMQKKPERRYHSASELIVDLKKSLTNPDGDFVQIPAFVTDDSPTINISDDLNKI
KNGSYYNNDSDYLSAYSNNNYNNNHNNSEIIDDDEDEDEELDTVDTKMEKIFSVLTIVAI
VVLFIAILFVVVRFIFPKGSKKPQGNQTATVSPSLEPTEEPTPSIEAEPTVETYQFPSVI
GHKFEDAKAAILAKDPDAVIIPQEEYSSEYEAGYVVRQYPHPNTDFPVGSEVTLYVSVGP
ENFALPSVYNMSKAEAEQKLRENGLVPKIESMHSNDVEEGKVIRTEPAKDSLVKEGDTIT
VYVSLGPEIVLKPVPNLIGKTLRDAESLLREAGLRVGRVNKESSENYASGQIIYQDTTAG
ELVEQGTKINITVSTGPKAKPTQPPKKKYIGTLIIDDINPLEHKELAEAEVILEMEQGGY
STEIYNKRTSASDFPIIVPNIEGESASVGIVKMYIDGEVFRLNEGDQAYEWYVEFETVEE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacccggtatgtttatcagcgatcggtatgagatcattgatagtgtcggttca
ggcggtatggcagatgtctataaggcaaaagaccatcggctgaaccgttttgttgcaatt
aaagtattaaaaccggaatattccagtgacaaaagttttgttaataaatttagaggagaa
gctcaatcagcggcaggattatcccatcctaatatagtaaatgtttatgatgttggtgat
gatggtggtctttattatattgtcatggaattggttgaaggtataacactaaaaaggttc
attgaaagaaaaggtaagcttgatgtaaaagaagctgtaggtatagccatacagatcgca
caagggttggaggctgcccatgataacaatattatccatagggatataaaacctcagaac
ataattatatccagagacggcaaggttaaagtaacagattttggaatcgccaaagcatca
aattccaatacaattacatcaaatgctatgggatctgttcactatttatctccggaacaa
gctaggggcggatatagtgacgaaaaaagtgatatctactctctgggagtaactttatat
gagatgctatcagggaaggttccctttgtgggagataataatgtttcagtggcattactc
catattcaaggggaagcagcaccccttagggaactagaggaagatatccccttaagtgtt
gataagatagttcagaagtgtatgcagaaaaaacctgagagaagatatcactctgcctct
gaattaatcgttgatttaaagaaatctttaaccaatccggatggggattttgttcaaatt
ccggcatttgttacagacgattccccaacgattaatatttccgatgatttgaataaaata
aaaaatgggtcttactataataacgatagtgactacctaagcgcttatagtaataataat
tacaataataatcataataatagtgaaattatcgatgatgatgaggatgaagacgaagag
ttagatacggtagatacaaagatggaaaagattttttccgttctaactatcgtagcaata
gttgtcttatttattgcaatattgtttgtggttgtacgttttatttttccaaaaggtagc
aaaaagccacagggtaaccagacagcaacagtgtctccttcccttgaacccactgaggaa
cctacaccttctatagaagcggaacctactgttgaaacttatcagttcccttcagtaata
ggtcataaatttgaggatgcgaaagcggctattttagctaaagatcctgatgcggtaata
ataccacaagaggagtattcttctgagtatgaagcgggatatgtagtaagacaatatcct
catccaaatacagatttccctgtaggttctgaggtaaccttatatgtaagtgtgggacct
gaaaactttgccctaccctctgtatataatatgagcaaagctgaagcagagcagaaatta
agagaaaatggtttagtacctaagatagaaagtatgcacagcaatgatgtagaagagggt
aaagtaatcagaacagaaccggctaaggattccttagtaaaagaaggagataccataaca
gtatatgtaagtttaggacctgaaattgttctaaaacctgttccaaatctaataggaaag
actcttagggatgcagaatccttgttaagagaggccggattacgtgtcggtagggtaaac
aaagaatcttctgaaaactatgcttcaggacagattatttatcaggatacgacggcagga
gaattagtagaacaaggaaccaagataaatattacagttagcaccggtcctaaggcaaaa
cctactcaacctccgaagaaaaagtatataggaacattaattattgatgatataaatcct
ttggaacataaagaacttgctgaagcagaagtaatattggaaatggaacaaggcggatac
agtaccgaaatctacaataaacggacatctgcttctgacttccctataatagttcctaat
attgaaggagaaagtgcctcagtaggaattgtaaaaatgtatattgatggtgaagtgttt
agactaaatgaaggcgatcaagcttatgaatggtatgtagaatttgaaacagtggaggaa
tag

DBGET integrated database retrieval system