KEGG   Herbinix luporum: SD1D_2008Help
Entry
SD1D_2008         CDS       T04072                                 

Definition
(GenBank) hypothetical protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
hsd  Herbinix luporum
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsd02000]
    SD1D_2008
Transporters [BR:hsd02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SD1D_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 SMC_N RsgA_GTPase PA28_beta AAA_27 AAA_30 AAA_10 AAA_29 SRP54
Motif
Other DBs
NCBI-ProteinID: CUH93544
UniProt: A0A0K8J7X9
LinkDB All DBs
Position
I:complement(2166408..2167457)
Genome map
AA seq 349 aa AA seqDB search
MIEVKNLVKRYGNHTAVDDLSFTVDKGQILGFLGPNGAGKSTTMNIITGYISATEGTVTV
NGVDVFEEPEEVKKMIGYLPEFPPLYPDLTVLEYLNFVADIKKVKRSLRKQMVEEVMEAT
KITDMRNRLIKHLSKGYKQRVGLAQAIMGYPELIILDEPTVGLDPKQIIEIRELIRELSK
NHTVILSSHIMQEVSAVCDSVMIIDKGKLILQDKPENLSMHFGSTGGLKLVIRGDKDSIM
KELGKIDRITKYEENEALEEGTINVTVYCKEDDDIREEVFYSMSKNKTPILEMQSIRMSL
EDIFLKVTQDNSSTDSSNAESEEADNNRKQPEEIISSKGEEEDSNAGDL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgattgaggtaaaaaatctagtaaagcgatatggaaatcataccgctgtagatgattta
tcatttaccgttgataaggggcagattcttggatttttaggacccaatggtgccggaaaa
tccaccactatgaatataataacaggttatatatctgccactgagggaacggtaacagtt
aatggggtggatgtatttgaagaacccgaagaagttaaaaagatgattggatatctgccg
gaatttccacctttatatccggatcttacggtattggaatatttaaattttgtggcagat
ataaagaaagtaaaacgatccttaagaaaacagatggtggaagaagttatggaagccact
aagataacagatatgaggaatcgtttgattaagcatttatctaaaggatacaagcaaagg
gttggtcttgcccaggccataatgggttatcctgagttaattattttagacgagcctact
gtgggacttgatccaaagcaaattattgaaataagggaattaatccgtgaactaagtaag
aatcatacggttatcctaagttcacatattatgcaggaagttagtgcagtatgtgacagc
gttatgataatagataaagggaaattaatattacaggataaaccggaaaatctcagtatg
cattttggttctaccggaggtttaaaactggtaatccgcggtgataaagattccataatg
aaagagcttggtaaaatagatagaattacaaagtatgaggaaaatgaagccctagaagaa
gggacaatcaatgtaactgtatattgtaaggaagatgatgatataagagaagaagttttc
tatagtatgagtaaaaacaaaacccctattttagagatgcagtccattagaatgagcttg
gaggatattttccttaaagttactcaggataacagctctaccgactcttctaatgctgag
tctgaagaagctgataataataggaaacagcccgaggaaataatatcatctaagggtgag
gaggaggattcaaatgctggcgatttataa

DBGET integrated database retrieval system