KEGG   Herbaspirillum seropedicae SmR1: Hsero_1082Help
Entry
Hsero_1082        CDS       T01268                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00250  Alanine, aspartate and glutamate metabolism
hse00410  beta-Alanine metabolism
hse00640  Propanoate metabolism
hse00650  Butanoate metabolism
hse01100  Metabolic pathways
hse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hsero_1082 (goaG)
   00650 Butanoate metabolism
    Hsero_1082 (goaG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hsero_1082 (goaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hsero_1082 (goaG)
Enzymes [BR:hse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Hsero_1082 (goaG)
Amino acid related enzymes [BR:hse01007]
 Aminotransferase (transaminase)
  Class III
   Hsero_1082 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADJ62599
UniProt: D8J1H8
LinkDB All DBs
Position
complement(1196209..1197489)
Genome map
AA seq 426 aa AA seqDB search
MTSKANNQELQQRKNAATPRGVGVMCDFYAERAANAELWDVEGRRFIDFAAGIAVLNTGH
RHPKLLDAMRAQMDKFTHTAYQIVPYASYVELAERINRLTPGNYPKKTAFFSTGAEAVEN
AIKIARAHTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLGFGPFPGDVFHAPYPSALHG
ITSEDALEAVKGLFKSDIEAKRVAAIILEPVQGEGGFYAAPADFMRGLRALCDEHGILLI
ADEVQSGYGRTGKLFAMEHYDVLPDLMTMAKSLAGGMPLSAVNGRAEIMDAPAPGGLGGT
YAGNPLAIASALAVLDVMEEEQLVTRGQRLGDKLQEHLKELRSSVPQIAEVRGVGAMVAV
EFADPATGKPDAEYTKKVQQHALNNGLLLLTCGSYGNVIRFLFPLTIPDTVMDEALGILA
KAIRLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaaggccaacaaccaagagctgcaacaacgaaagaacgccgctaccccgcgc
ggcgtgggcgtgatgtgcgacttctacgccgagcgcgcagccaatgccgagttgtgggat
gtggagggccgccgcttcatcgacttcgctgccggcatcgccgttctcaataccggccat
cgtcatcccaagctgctcgacgccatgcgcgcgcagatggacaagttcacccacacggcc
taccagatcgtgccctacgccagctacgtggaactggccgagcgcatcaaccgcctcacg
ccgggcaactatccgaagaagaccgccttcttctccaccggcgccgaagcggtggaaaac
gccatcaagatcgcccgcgcccacacgggccgtccgggcgtgatcgcctttgccggcggc
ttccatggccgcaccatgatgggcatggcgctcaccggcaaggtcgcgccctacaagctg
ggtttcggccccttccccggtgacgtcttccatgccccctaccccagcgcgctgcacggc
atcaccagcgaagatgcgctggaagccgtcaagggcctcttcaagagcgacatcgaagcc
aagcgcgtcgcggccatcatcctggaaccggtgcagggcgaaggcggcttctacgccgcc
ccggccgacttcatgcgcggcctgcgcgccctctgcgacgaacacggcatcctgctgatc
gccgacgaagtgcagtccggctatggccgtaccggcaagttgtttgcgatggaacattac
gatgtcctgcccgacctgatgaccatggccaagagcctggcgggcggcatgccgctgtcg
gcggtcaatggccgcgccgagatcatggatgcgccggcccctggcggcctgggcggcacc
tacgcgggcaacccgctggccatcgcctcggcgctggcggtgctggacgtgatggaagaa
gaacagctggtgacgcgtggccagcgcctgggcgacaagctgcaggagcacctgaaggaa
ctgcgttcatccgtgccgcagatcgccgaagtgcgtggcgtgggcgcgatggtggcggtg
gagtttgccgatccggccaccggcaagcccgatgccgagtacaccaagaaggtccagcag
catgcgctcaacaacggcttgctgctgctgacctgcggcagctacggtaacgtgatccgc
ttcttgttcccgctgacgattcccgataccgtcatggacgaagcgctgggcatcctggcc
aaggctatccggctggcctga

DBGET integrated database retrieval system