KEGG   Herbaspirillum seropedicae SmR1: Hsero_1094Help
Entry
Hsero_1094        CDS       T01268                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
KEGG Orthology (KO) [BR:hse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hsero_1094 (idnD)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Hsero_1094 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ADJ62611
UniProt: D8J1J0
LinkDB All DBs
Position
1241020..1242057
Genome map
AA seq 345 aa AA seqDB search
MQQGLVIHAPHDLRIQALDTGALQPQQLKVKVKAGGICGSDLHYYHHGGFGVVRIKEPMV
LGHEVSGQIAEVGTAVTDIAPGTRIAISPSRPCGACKYCQEGKQNHCLDMRFYGSAMRTP
HVQGAFRQEIIIERSQAHVVADHVSDGEAAMAEPLSVALHAVRRAGPLVGKRVLVTGCGP
IGALVVVAARRAGALEVVVTDVASMPLQAALQVGADSAINMAETPAALKAYAADKGTFDV
LFEASGNERALVGALEALRPQAIIVQVGLGGDIQFPANLLVGKELEWRGAFRFHEEFAMA
VELMNRKLVDVKPLITATYPIAQAVEAFEIAGDRSRMMKVQISFD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaggcctcgtcatccatgcgccgcacgacctgcgcatccaggcactggacacc
ggcgcactgcagccgcagcaactgaaggtcaaggtcaaggccggcggcatctgcggctcg
gacctgcactactaccatcacggcggcttcggcgtggtgcgcatcaaggaaccgatggtg
ctgggccatgaagtctcgggccagatcgccgaagtcggtacggccgtcaccgacatcgct
cccggcacgcgcatcgccatctcgcctagccgcccctgcggcgcgtgcaagtactgccag
gaaggcaagcagaaccattgcctggacatgcgcttctacggcagcgccatgcgcacgccg
cacgtgcagggcgccttccgccaggaaatcatcatcgaacgttcgcaggcccacgtcgtc
gctgaccacgtcagcgatggcgaagccgccatggccgagccgctgtcggtggcgctgcac
gcggtgcgccgcgccggcccgctggtgggcaagcgcgtgctggtgaccggctgcggtccc
atcggcgcgctggtggtggtggctgcgcgccgcgccggggcgctggaagtggtggtcacc
gatgtggccagcatgccgctgcaggcggccttgcaggtgggggcggacagcgccatcaac
atggccgagacgcccgctgccctgaaggcctatgccgccgacaaggggaccttcgatgtg
ctcttcgaggccagcggcaatgagcgcgcgctggtgggcgcgctggaagccctgcgcccg
caggccatcatcgtgcaggtcggcctgggcggcgacatccagttcccggccaacctgctg
gtgggcaaggagctggagtggcgcggcgccttccgcttccatgaagagttcgccatggcg
gtggagctgatgaaccgcaagctggtggatgtgaagccgctgatcacggcgacctatccc
attgcccaggcagtggaagccttcgagatcgccggcgaccgctcgcgcatgatgaaggtg
cagatcagttttgactga

DBGET integrated database retrieval system