KEGG   Herbaspirillum seropedicae SmR1: Hsero_1684Help
Entry
Hsero_1684        CDS       T01268                                 

Gene name
dadA
Definition
(GenBank) glycine/D-amino acid oxidase (deaminating) protein
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00360  Phenylalanine metabolism
hse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Hsero_1684 (dadA)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     Hsero_1684 (dadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 Pyr_redox ApbA FAD_binding_2 HI0933_like UDPG_MGDP_dh_N AlaDh_PNT_C 3HCDH_N FAD_binding_3 Thi4 Glyco_transf_4 GIDA
Motif
Other DBs
NCBI-ProteinID: ADJ63197
UniProt: D8IQT6
LinkDB All DBs
Position
complement(1907188..1908489)
Genome map
AA seq 433 aa AA seqDB search
MRVVILGSGVIGVTSAWYLARAGHDVTVLDRQPGPALETSFGNAGQISPGYASPWAAPGI
PLKAIKWMFQEHAPLAIRLDGSFNQLRWMWQMLRNCNAERYAVNKERMVRLAEYSRDCLR
DLRADVGIPYEGRQQGTLQLFRSQEQLEGAAKDIAVLKEAGVPFELLTPDQLGNAEPALA
KVRDKLTGGLRLPNDETGDCQLFTTRLATMAEQIGVKFRYGVDIDALAMAGGKIAGVVCG
KELVQADSYVVALGSYSPQLLGEVPGLPAIPVYPLKGYSITVPITDASAAPVSTILDETY
KIAVTRFDDRIRVGGMAEIVGYDTALKAKRRATLELVVNDLFPGAGDTAQASFWTGLRPM
TPDGTPVVGATPVSNLYINTGHGTLGWTMSCGSGQLLADLISGRRPAIAHEDLSVERYLS
SGGRAQTPRLAGA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtcattcttggaagcggtgtcatcggcgtcaccagcgcctggtatctggcc
cgcgccggccacgacgtcaccgtgctggaccgccagcccggcccggcgctggaaacctcg
ttcggcaacgccggccagatctccccgggttatgcatcgccctgggccgccccgggcatt
ccgttgaaggccatcaagtggatgttccaggagcacgccccgctggccatccgcctcgac
ggcagcttcaaccagctgcgctggatgtggcagatgctgcgcaactgcaatgccgagcgt
tacgccgtcaacaaggaacgcatggtgcgcctggccgaatacagccgcgactgcctgcgc
gacctgcgtgccgacgtcggcattccctatgaaggccgccagcaaggcaccctgcaactg
ttccgcagccaggagcagttggaaggcgcggccaaggatatcgccgtgctcaaggaagcc
ggcgttcccttcgaactgctgaccccggaccagttgggcaatgccgaaccggcgctggcc
aaggtgcgcgacaagctcaccggcggcctgcgcctgcccaatgacgagactggcgattgc
cagctcttcaccacccggctggcgacgatggcagaacagatcggcgtgaagttccgctac
ggcgtggacatcgatgcgctggccatggccggcggcaagatcgctggcgtggtgtgtggc
aaggaactggtgcaggcggacagctatgtggtggcgctgggatcgtattcgccgcagctg
ctgggcgaggtgccgggcctgccggccatcccggtctatccgctcaagggctactccatc
accgtccccatcaccgacgcctcggcggccccggtctcgaccatcctggacgaaacctac
aagatcgccgtgacccgcttcgatgaccgcatccgcgtgggcggcatggccgagatcgtc
ggttacgacaccgccttgaaggccaagcgccgcgccacgctggagctggtggtcaacgac
ctcttcccgggcgccggcgacaccgcccaggccagcttctggaccggcctgcgcccgatg
accccggacggcaccccagtggtcggcgccacgccggtctccaatctctacatcaacacc
ggccatggcaccctgggctggaccatgtcctgcggctcggggcagttgctggccgacctg
atctcgggtcgtcgtccggccattgcccacgaagacctgtcggtggagcgctacctctcc
tccggcggtcgcgcgcagacgccgcgcctggcgggcgcatga

DBGET integrated database retrieval system