KEGG   Herbaspirillum seropedicae SmR1: Hsero_1896Help
Entry
Hsero_1896        CDS       T01268                                 

Gene name
exaC
Definition
(GenBank) NAD+ dependent acetaldehyde dehydrogenase protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00620  Pyruvate metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_1896 (exaC)
   00620 Pyruvate metabolism
    Hsero_1896 (exaC)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Hsero_1896 (exaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ADJ63405
UniProt: D8IS61
LinkDB All DBs
Position
2152739..2154259
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVRDPFKQRYDNFIGGKFVPPVKGEYFENISPVIGRAFCEVARSSAEDVEL
ALDAAHAAKKSWGKTSPTERANMLLKIADRMEANLELLATAETLDNGKPIRETMAADIPL
AIDHFRYFAAAVRTQEGSICPIDNDTYAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIADLIPPGVVNIVQGFGVEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDDFFDKALEGFAMFALNQGEV
CTCPSRVLVQESIYERFIERALKRVAAIKQGNPLDKSTMIGAQASQEQLEKILSYIDIGK
QEGAKVLAGGGREELGGDLASGYYVKPTVFQGNNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGLWTRDGTRAFRMGREIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcagacatcagcaaactcggcgtacgcgaccccttcaagcaacgttacgac
aatttcatcggtggcaaattcgtgccgccggtcaagggtgaatacttcgagaacatcagc
ccggtgatcggacgcgccttctgtgaagtggcccgctccagcgccgaagacgtggagctg
gcgctggacgccgcccacgcagccaagaagagctggggcaagacctcccccaccgagcgc
gccaatatgctgttgaagatcgccgaccgcatggaagccaacctggagctgctggccact
gccgaaaccctggacaacggcaagcccatccgcgagaccatggccgccgacatcccgctg
gccatcgaccacttccgctatttcgccgctgccgtgcgcacccaggaaggcagcatctgc
cccatcgacaatgacacctacgcctaccacttccatgagcctctgggcgtggtcggccag
atcatcccctggaacttccccatcctgatggcggtgtggaaactggccccggcgctggcc
gccggcaattgcgtggtgttaaagcccgccgagcagaccccggcctccatcatggtgctg
atcgaactgatcgccgacctgatcccgccgggcgtggtcaacatcgtgcagggctttggc
gtggaagccggcaagccgctggcctccaacaagcgtatcgccaagatcgccttcactggc
gagaccaccactggccgcctgatcatgcaatacgcttcgcagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaatatcttcttcgccgacgtgctggacaaggatgac
gacttcttcgacaaggccctggaaggctttgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccctcgcgcgtgctggtgcaggaatcgatctacgagcgcttcatcgagcgc
gccttgaagcgcgtggcggccatcaagcagggcaatccgctggacaagagcaccatgatc
ggcgcgcaggcctcgcaggaacagctggaaaagatcctgtcctacatcgacatcggcaag
caggaaggcgccaaggtgctggccggcggcgggcgcgaagaactgggcggcgacctggcc
tcgggctactacgtcaagccgaccgtgttccagggcaataacaagatgcgcatcttccag
gaagaaatctttggcccggtggtctcggtgaccaccttcaaggatgaagaagaagcgctg
gccattgccaatgacacgctgtacggcctgggcgcgggcctgtggacccgggatggcacg
cgcgccttccgcatggggcgtgagatccaggctggccgtgtctggaccaactgctatcac
ctctatccggcgcatgcggccttcggcggctacaagcaatccggcatcggccgcgaaaac
cacaagatgatgctggaccactaccagcagaccaagaacctgctggtcagctacagcccg
aaggcgctgggcttcttctga

DBGET integrated database retrieval system