KEGG   Herbaspirillum seropedicae SmR1: Hsero_2271Help
Entry
Hsero_2271        CDS       T01268                                 

Definition
(GenBank) ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Hsero_2271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hse03400]
    Hsero_2271
Enzymes [BR:hse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hsero_2271
DNA repair and recombination proteins [BR:hse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Hsero_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADJ63770
UniProt: D8IUA8
LinkDB All DBs
Position
2563648..2566218
Genome map
AA seq 856 aa AA seqDB search
MSTGKLDRYRAKRDFTITPEPSGHASRSRAGAQSQSLQFFIQRHHARRLHYDFRLELDGV
LKSWAVPKGPSLDPHDKRLAVRVEDHPFDYGSFEGDIPAHQYGAGHVVLWDRGQWRPHGD
ARAGLAKGHLSFELEGEKLHGRWALVRMGKPAADGKENWLLIKDDDAAAASGEQAAITEL
RPESVKDLGDQAPLAKARASAKAAPDSTGPMPAQMQAQLATLVDRAPAGEQWLCELKFDG
YRGLCRIDHGQAAIYTREGLDWSHRWPILVQALARLPVDEAWIDGEVVALDAQGQISFEA
LQNLARGDRQQADGIRLALYAFDLLYLNGHDLRDIPLRQRKALLRELIPGSDPEGLLLYS
EHIEGHAAEVFRHACQHGMEGIVLKRADAPYTGRRDRYWLKLKCEHRQEFVIAGYTEPAG
QRSGFGAILVGVYDEHEQLRYAGRVGTGFDDKLLETLLKQFGPLEQDQPAFANPPTGQQR
RGVHWLRPALVAEVRFAQWTSAGILRHGSFVALREDKDPHQIRREGPQPLAEAKADAKAP
AAAPARSRGKASDLSAPVTVAGVKLTHPGKILFPDTGLTKLELARYYQSVAPWILPELRQ
RPLSLVRCPDGHAGKRFFQKHTGQGMPEAIDTIEVPEGEGHAQYMMVNDVAGLVATVQMG
VLELHAWGATGAALNHPDRVVFDLDPADDVPWATVVEGAQLVRGLLKEIGLDCFLKTSGG
KGLHVMVPIRPEHDWAVVKDWAHRFAAHLARHLPDRFIAKMSKAARNGKIFIDYLRNAPG
ATTVVAYSVRARDGAPVSVPITWEELEQGKGIKADHFRVSTMPARIRSLEQHDPWAHFGQ
APQRLTKAMLAAFDSV
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggcaagctcgaccgctaccgcgccaagcgcgatttcaccatcacgcccgaa
ccctccggtcatgccagccggagccgggcaggggcgcagtcgcagagcctgcaattcttc
atccagcgccaccatgcgcgccggctgcattatgactttcggctcgagctcgacggtgtg
ctcaagagctgggccgttcccaagggccccagcctggacccacacgacaagcgactggcc
gtgcgggtcgaggaccatcccttcgactacggcagcttcgagggcgacatccccgcgcac
cagtatggcgccggccatgtggtcttgtgggatcgcggtcagtggcgaccgcacggcgat
gcgcgcgccgggctggcaaaaggtcatctgagctttgagctggagggcgaaaaactgcac
ggccgctgggcactggtgcgcatgggcaagcccgccgccgacggcaaggaaaactggctg
ctgatcaaggacgacgacgccgctgcggccagcggcgagcaagcggccatcaccgaactg
cgccccgagagcgtcaaggatctgggcgaccaggcgccgctcgccaaggccagagcaagc
gccaaagccgcgccggacagcaccggtccaatgcccgcgcagatgcaggcgcaactggcc
actctggtcgatcgcgctcccgcaggcgagcaatggctgtgcgagctgaagttcgatggg
tatcgcggcctgtgccgcatcgatcacggccaagccgccatctacacccgggaaggcctg
gactggagccatcgctggcccatcctggtgcaggcgctggcgcgcttgccggtcgatgaa
gcctggatcgatggcgaggtcgtggcgctggacgcgcaaggacagatcagcttcgaagcc
ttgcagaacctggcgcgcggggatcgccagcaggccgatggcatccgcctggcgctgtat
gccttcgatctgctgtacctgaacggccacgacctgcgcgacattcccctgcgtcagcgc
aaggcgttgctgcgtgaactgatccccggttcggacccagagggactgctgctctacagc
gaacacatcgagggccatgccgccgaagtgttccgccacgcctgccagcatggcatggaa
gggatcgtgctcaagcgcgccgatgccccgtacacagggcggcgcgaccgctactggctc
aagctcaagtgcgagcatcggcaagagttcgtcatcgccggctataccgaacccgccggc
caacgcagcggctttggggccatcctggtgggagtctacgatgagcacgagcagttgcgc
tacgccgggcgggtgggcaccggtttcgatgacaagctgctggagacgctgctcaagcag
ttcggcccgctggagcaggaccagccagcctttgccaatccacctaccggccagcagcgg
cgcggggtccattggctcaggccggcgctggtggccgaggtgcgctttgcccaatggacc
agcgccggcatcctgcgccatggcagcttcgtggccctgcgcgaagacaaggacccgcac
cagatccgacgcgaaggcccgcagcccctcgccgaggcaaaggccgatgccaaggcgccg
gccgctgcgcccgcgcgcagccgtggcaaggccagcgatctctctgcacccgtcaccgtg
gccggggtgaagctgacccatcccggcaagatcctctttcccgataccgggctgaccaag
ctggaactggcgcgctattaccagagcgtggcgccgtggatattgcccgaactcaggcaa
cgaccgctgtcgctggtgcgttgcccggacggacatgctggcaagcgcttcttccagaag
cacaccgggcaaggcatgcccgaggccatcgacaccatcgaggtgccggaaggcgagggc
catgcccagtacatgatggtcaacgatgtggccggcctggtcgccaccgtgcagatgggc
gtgctggagctgcatgcctggggcgcgaccggcgctgccctgaatcaccccgaccgcgtg
gtgttcgacctcgatcctgctgacgacgtaccctgggccacggtggtggagggcgcccag
ctggtgcgggggctgttgaaagagatcggactggactgtttcctcaagacctcgggtggc
aagggtctgcatgtgatggtgccgatccggccggaacacgactgggccgtggtcaaggat
tgggcgcaccggttcgccgcgcacctggcgcggcacctgccggaccgtttcatcgccaag
atgagcaaggccgctcgtaacggcaagatctttatcgactatctgcgcaatgcgcccggc
gcgaccacggtggtggcctattcggtgcgcgcccgcgatggtgcgccggtgtcggtgcca
atcacctgggaagagctggaacagggcaagggcatcaaggccgatcatttccgggtgtcc
accatgccggcgcgcatccgcagcctggagcagcacgatccttgggcccacttcgggcag
gctccgcagcgcctcaccaaggccatgctggcggcctttgacagcgtctga

DBGET integrated database retrieval system