KEGG   Herbaspirillum seropedicae SmR1: Hsero_2925Help
Entry
Hsero_2925        CDS       T01268                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00620  Pyruvate metabolism
hse00680  Methane metabolism
hse01100  Metabolic pathways
hse01120  Microbial metabolism in diverse environments
hse01200  Carbon metabolism
Module
hse_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hsero_2925 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    Hsero_2925 (ppc)
Enzymes [BR:hse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Hsero_2925 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADJ64414
UniProt: D8IZS4
LinkDB All DBs
Position
3322666..3325578
Genome map
AA seq 970 aa AA seqDB search
MATTNPTKRSARSAPSTSRSAGANPAATSITPSKPARGADKDAPLKEDIRLLGRLLGEVL
REQEGDEVFEVVETIRQTAVRFRRESDAKAGAELDKLLKKLTRDQTNSVVRAFSYFSHLA
NIAEDQHHNRRRRAHLLAGSEAQPGSVAYALSRLDDAGVSGAQVRNFLKEALVSPVLTAH
PTEVQRKSILDAEREIARLVAERDLPLTPRELRHNTELLRARIATLWQTRMLRYTKLTVA
DEIENALSYYRTTFLRELPALYEDIEAEIDSQFPARGKSRPTELPPYVQMGSWIGGDRDG
NPNVNAGTMQHALQRQSTVVFDYYLEEVHTLGAELSISTLMVDASPELLALAATSPDHSE
HRADEPYRRALIGIYARLAATARALGAINILRQEVGAAAPYETPEQCVAELDVLVSSLQA
HHGAALVKPRLAGLKRAVEIFGFHLATLDMRQSSDIHERVLADLFAKAQVEADYAALNEE
RKIALLLGELSRPRLLHSPYLEYSEQTDSELSILRAAREIRRRYGERAIRNYIISHTETL
SDLLEVLLLQKETGLLHIEGNQLRELELMVIPLFETIPDLRCAAEIMRGWLSLPQVKGLI
AKHGKLQEVMLGYSDSNKDGGFLTSNWELYKAENQLVELFNEAGVKLRLFHGRGGTVGRG
GGPSYQAILAQPPGTVNGQIRLTEQGEIIASKFANPEIGRRNLELLVAATLEASLMPTNA
DDKEARKLAEFERVMEELSERAYRAYRNLVYETPGFTDYFFAATPIAEIAQLNIGSRPAS
RKATQRIEDLRAIPWGFSWGQCRLLFPGWYGFGSAVSGWLEDAGNAKEAARRLATLRAMC
KEWPFFAALLSNMDMVLSKTDLAVASRYAGLVADRKLRNAIFGRITDEHERTSAMLSTIT
GSKERLAANPLLARSIKNRFAYLDPLNHLQVELIKRHRATVAAKRTPEERVQRGIHLTIN
GVAAGLRNTG
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgactacaaatccaactaaacgcagtgcccgttcggctccatccacctcccgttcc
gccggcgccaaccccgccgcaaccagcattacccccagcaaacccgcccgcggcgccgac
aaggatgcgccgctcaaggaagacatccgcctgctcggccgcctgctcggcgaggtgctg
cgcgaacaggaaggcgatgaggtcttcgaggtcgtggaaacgatccgccagactgccgtg
cgctttcgccgcgaatccgacgccaaggccggcgccgagctggacaagctgttgaagaag
ctgacccgcgaccagaccaattcggtggtgcgcgccttctcctacttctcgcacctggcc
aacatcgccgaagaccagcaccacaaccgccgccgccgcgcccacctgctggccggttcc
gaggcccagccgggcagcgtggcctatgcgctctcgcgtctggacgacgctggcgtctcg
ggtgcacaggtgcgcaatttcctcaaggaagcgctggtgtcgccggtgctcacggcccac
ccgaccgaggtgcagcgcaagtccatcctggacgccgagcgtgagatcgcccgcctggtg
gccgaacgcgacctgccgctgacgccccgcgagctgcgccacaacaccgaactcttgcgc
gcgcgcatcgctacgctgtggcagacccgcatgctgcgctataccaagctgaccgtggcc
gacgagatcgagaacgccctctcctactaccgcaccaccttcctgcgcgaactgccggcg
ctgtatgaggacatcgaagccgagatcgacagccagttcccggcacgcggcaagagccgt
cccaccgaactgccgccctacgtgcagatgggcagctggatcggcggcgaccgcgacggc
aaccccaatgtcaatgccggcaccatgcagcatgccttgcagcgccagtccacggtggtg
ttcgactactacctggaagaagtgcatacgctgggcgcagagctgtccatctcgaccctg
atggtcgatgccagccccgaattgctggccctggcggcgacctctccggatcattccgag
caccgtgccgacgagccctaccggcgcgccctcatcggcatctatgcgcgcctggcggct
actgcccgcgcgctgggcgcgatcaacatcctgcgccaggaagtgggcgccgctgcgccc
tacgagacgcccgagcaatgcgtggccgagctggacgtgctggtcagttcgctgcaggcg
catcacggcgctgcgctggtcaaaccacgcctggcgggcttgaagcgcgccgtcgagatc
ttcggcttccacctggccacgctggacatgcgccagagttcggacatccacgagcgcgtg
ctggccgatctgtttgccaaggcccaggtcgaggccgactatgccgccctgaacgaggag
cgcaagatcgccctgctgctgggcgagctgtcgcgcccgcgcctgctgcattcgccctac
ctggaatattccgagcagactgattccgagctctccatcctgcgcgcggcccgcgagatc
cgccgccgctatggcgagcgcgccatccgcaactacatcatctcgcacaccgaaaccctg
tcggacctgctggaagtgctgctgctgcaaaaggaaaccggcctgctgcacatcgagggc
aaccagttgcgcgaacttgagctgatggtcattccgctgttcgagaccatccccgacctg
cgctgcgccgccgagatcatgcgcggctggctgagcctgccgcaggtcaagggcctcatc
gccaagcacggcaagctgcaggaagtcatgctgggttattcggactccaacaaggatggc
ggcttcctgacctccaactgggagctgtacaaggccgagaaccagctggtggaactgttc
aacgaagccggcgtgaagctgcgcctcttccacggtcgcggcggcaccgtcggccggggc
ggcggccccagctaccaggccatcctggcgcagccgccgggtaccgtcaacggccagatc
cgcctgaccgaacagggcgagatcatcgcctccaagttcgccaatccggagatcggccgc
cgcaacctggaactgctggtggccgccacgctggaggccagcctcatgcccaccaatgcc
gacgacaaggaagcccgcaagctggccgagttcgaacgggtcatggaagagttgtccgaa
cgcgcctatcgcgcctatcgcaacctggtctatgagaccccgggcttcaccgactacttc
tttgccgccaccccgattgccgaaatcgcgcaactgaacatcggttcgcgccccgcttcg
cgcaaggccacccagcgcatcgaagacctgcgcgccattccgtggggcttctcctggggc
cagtgccgcctgctcttccccggctggtatggctttggcagcgccgtctcgggctggctg
gaagacgccggcaatgccaaggaagcagcgcgccgcctggccacgctgcgcgccatgtgc
aaggaatggccattcttcgcggcgctgctgtcgaacatggacatggtgctctccaagacc
gacctggccgtggcctcgcgctacgctgggctggtggccgaccgcaagctgcgcaacgcc
atcttcgggcgcatcaccgacgagcacgaacgcaccagcgccatgctctccaccatcacc
ggcagcaaggagcggctggcagccaatccgctgctggcgcgctcgatcaagaaccgcttc
gcctatctcgacccgctgaaccacctgcaggtcgagctgatcaagcgtcaccgcgccacg
gtggccgccaagcgcacgccggaagaacgcgtgcagcgcggcatccacctgaccatcaat
ggcgtagccgccggcttgcgcaacaccggctag

DBGET integrated database retrieval system