KEGG   Herbaspirillum seropedicae SmR1: Hsero_3396Help
Entry
Hsero_3396        CDS       T01268                                 

Definition
(GenBank) D-xylulose reductase protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00040  Pentose and glucuronate interconversions
hse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hsero_3396
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Hsero_3396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP DAO Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADJ64877
UniProt: D8IPI0
LinkDB All DBs
Position
3894336..3895373
Genome map
AA seq 345 aa AA seqDB search
MQALVLEATRELKLREIDLPQQMGAQDVRIRIHTVGICGSDLHYYTHGSIGPFKVEAPMV
LGHEASGTVIEVGSAVSHLKVGDRVCMEPGIPRLDSPATLRGMYNLDPAVRFWATPPIHG
CLTGSVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAATKARMKPGDTAVVIGAGTIGAM
TALAALAGGAARVILADVVAEKLAHFADNPAVITVDVTRETLTDVVRQATDGWGADVVFE
ASGHAGVYQTLLDLVCPGGCAVLVGMPPAPVALDVVAMQTKEVRLESVFRYANIFPRALA
LISSGMIDVKPFISRKFPFSQSIRAFEEAASGRPQDVKIQIEMEG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctcgtactcgaagccacccgcgaactcaagctgcgcgagatcgacctgccg
caacagatgggcgcgcaggatgtgcgcatccgcatccacaccgtgggcatctgcggcagc
gacctgcactactacacccatggcagcatcggccccttcaaggtggaagcgccaatggtg
ctgggccatgaagcctcgggcaccgtcatcgaagtgggcagcgcagtcagccacctcaag
gtcggcgaccgcgtctgcatggagccgggcatcccgcgcctggattcgccggccacgctg
cgcggcatgtacaacctcgaccctgcggtgcgtttctgggccacgcctcccatccatggc
tgcctgaccggcagcgtggtgcatccggcggccttcacctaccgcctgccggacaacgtc
agctttgccgaaggggccatcgtcgaacccttgtccatcggcctgcaagccgccaccaag
gcgcgcatgaagccgggcgacaccgccgtggtcatcggcgccgggaccatcggcgcgatg
actgccctggcggccttggccggcggtgcggcacgcgtgatcctggccgatgtggtggcc
gagaagctggcgcactttgccgataacccggcggtgatcaccgtggacgtgacgcgggag
acgctgaccgacgtggtgcgccaggctaccgatggctggggtgcggacgtggtattcgaa
gcttcggggcatgcgggggtctaccagaccctgctggacctggtctgcccgggtggatgt
gcggtgctggtgggcatgccgccagcgccagtggcgctggatgtggtggccatgcagacc
aaggaagtgcgactggaatcggtgttccgctatgccaacatcttcccgcgtgcgctggcc
ctgatcagctcggggatgatcgacgtcaagcccttcatctcgcgcaagttccccttctcg
caaagcatccgcgccttcgaggaagccgccagcggacgtccgcaggacgtcaagatccag
atcgagatggaaggctga

DBGET integrated database retrieval system