KEGG   Halanaeroarchaeum sulfurireducens M27-SA2: HLASA_1207Help
Entry
HLASA_1207        CDS       T04261                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hsf  Halanaeroarchaeum sulfurireducens M27-SA2
Pathway
hsf00630  Glyoxylate and dicarboxylate metabolism
hsf01100  Metabolic pathways
hsf01120  Microbial metabolism in diverse environments
hsf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HLASA_1207 (rbcL)
Enzymes [BR:hsf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HLASA_1207 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALG82101
UniProt: A0A0F7P998
LinkDB All DBs
Position
complement(1181693..1182940)
Genome map
AA seq 415 aa AA seqDB search
MPGISYEDFVDTGYLPSDSDLVCEFAIEPAAGLDMVDAAGRVASESSNGTWATLDVSEDV
VDLSATAFRIEDGEIAVAYPRDLFEGGNMAQILSCIAGNIMGMKAVDAIRLLDVRWPEAI
VETFRGPQFGSAVKSEFLDAGDRPALATVPKPKVGLTTDDHVEIARRAWLGGIDLLKDDE
NLTNQSFNGFEDRLTHTLEMRDRVEEETGDSKGYLVNITANADEMKRRADLVAAQGGDFV
MVDVVTTGWAAVASVREHTDDLDVAIHAHRAMHAAFDRVENHGVAMRVLAQIARLVGVDH
IHTGTANLGKLANEDTVGINDWLADDLYGLNDVLPVASGGLHPGTVKPLLDRIGTNVMIQ
AGGGVHGHPDGTEAGARAFRQAVDAYRDDVSPDEYAEDHPELAAALDNWGTHTPR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaatatcgtacgaggacttcgtcgatacggggtatttgccttctgacagcgac
ctggtctgtgagttcgccatcgaaccagctgcgggactcgatatggtggacgcggccggt
cgcgtggcgtccgaaagttccaacgggacctgggcaacgctcgacgtcagcgaggatgtc
gtggacctgagtgcgacggcgttccgaatcgaagacggcgagattgccgtcgcctatccc
cgtgacctcttcgagggcgggaacatggcccagattctgtcctgtatcgccgggaacatc
atggggatgaaggcagtcgatgccatccgccttctggacgtccggtggcccgaggccatc
gtcgagaccttcaggggcccgcagttcggttcggcggtaaaatcggagttcctcgacgcc
ggggaccgaccagcgctggcgaccgtcccgaagccgaaggtcggattgactaccgacgat
cacgtggaaatcgctcggcgtgcctggctcggtggtatcgacctgctgaaagacgacgag
aacctgacgaaccagtcgtttaacggattcgaggaccgcctcacacacacgctggagatg
cgggatcgagtcgaggaggaaaccggcgattcgaagggatacctcgtcaacatcacggcg
aacgccgacgagatgaagcgtcgtgccgacctggtggcagcgcagggtggggacttcgtg
atggtcgacgtggtgacgacggggtgggctgccgttgcgtcggtccgcgagcacaccgac
gacctcgacgtggccattcacgcccaccgggcgatgcacgcggccttcgatcgggtggaa
aaccacggcgtggccatgcgggtgctggctcagatcgctcggctggtcggcgtggatcac
attcacacgggaacggcgaacctcggcaaactggcaaacgaggacacggtgggaatcaac
gattggctcgcggacgatctctacggattgaacgacgtgttaccggtcgcgtccggtggt
ctccatccaggcacggtcaagcccctcctcgatcggatcgggacgaacgtgatgatacag
gcagggggcggtgtccatgggcaccccgatgggacggaagccggtgcccgcgcgtttcgt
caggcggtcgatgcgtatcgggacgacgtttctcccgacgaatacgccgaagatcacccg
gaactcgccgccgcgctggacaactgggggacccataccccacgctaa

DBGET integrated database retrieval system