KEGG   Halanaeroarchaeum sulfurireducens M27-SA2: HLASA_2171Help
Entry
HLASA_2171        CDS       T04261                                 

Gene name
argA
Definition
(GenBank) arginine biosynthesis regulator
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
hsf  Halanaeroarchaeum sulfurireducens M27-SA2
Pathway
hsf00300  Lysine biosynthesis
hsf01100  Metabolic pathways
hsf01210  2-Oxocarboxylic acid metabolism
hsf01230  Biosynthesis of amino acids
Module
hsf_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:hsf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HLASA_2171 (argA)
Enzymes [BR:hsf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     HLASA_2171 (argA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_5 ATPgrasp_YheCD Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: ALG83040
UniProt: A0A0F7PH66
LinkDB All DBs
Position
2097310..2098200
Genome map
AA seq 296 aa AA seqDB search
MTVDVGLLYSRIRQDEKLLLAELRDRGHEVHKVDVRDQQFGPQESSADFDAMDVVLDRTL
ATSRSLYTTSFLDAYDVPVINDAETARVCADKVQTTLALAQADVQTPETKVAYTVDSAME
AIESFGYPVVLKPVVGSWGRLLARIEDEHAAEALLEHKATLGHYEHKVFYIQEFVDKPGR
DFRVLALDGTPVAGMVRSSDHWLTNAAKGAKTAELEITPEIAEIVENASAAVGGGMLGID
IMETEDGEYTVHEINHTVEFKALTDAVEVDVPAAVVDWLEVKVAQSTEGSTGEVTA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtggacgtcggcctcctctactcccggatccgccaggacgagaagctcctcctc
gccgagctgcgcgaccgcggccacgaggtgcacaaggtggacgtccgcgaccagcagttc
ggcccccaggagtcgagtgcggacttcgacgcgatggacgtcgtcctggaccggacgctc
gcgaccagtcggtcgctttacaccacgagcttcctcgacgcctacgacgtgcccgtgatc
aacgacgcggagacggcccgcgtctgtgccgacaaggtccagaccacgctcgcactcgcg
caggccgacgtccagaccccggagacgaaagtcgcgtacaccgtcgacagcgcgatggag
gccatcgagtcctttggctaccccgtcgtgctcaagcccgtggtcggttcgtggggccgg
ctgttggcccggatcgaggacgaacacgccgccgaggccctcctcgagcacaaggcgacg
ctgggacactacgagcacaaggtgttctacatccaggagttcgtcgacaagccgggccgc
gacttccgggtactcgcgctcgacggcaccccggtcgccggaatggttcgctcctcggat
cactggctgacgaacgccgcgaagggcgcgaagacggccgaactcgagatcacgccagag
atcgccgagatcgtcgagaacgcgagcgcggcggtcggcggcggcatgctcggcatcgac
atcatggagaccgaggacggcgagtacaccgttcacgagatcaatcacacggtcgagttc
aaggcgctgaccgacgccgtcgaggtcgacgttcccgcggcggtcgtcgactggctcgag
gtgaaagttgcccaatcgaccgagggctccaccggcgaggtgaccgcctga

DBGET integrated database retrieval system