KEGG   Halomonas aestuarii: BOX17_03420Help
Entry
BOX17_03420       CDS       T04554                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00020  Citrate cycle (TCA cycle)
hsi00270  Cysteine and methionine metabolism
hsi00620  Pyruvate metabolism
hsi00630  Glyoxylate and dicarboxylate metabolism
hsi00680  Methane metabolism
hsi01100  Metabolic pathways
hsi01110  Biosynthesis of secondary metabolites
hsi01120  Microbial metabolism in diverse environments
hsi01130  Biosynthesis of antibiotics
hsi01200  Carbon metabolism
Module
hsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsi_M00012  Glyoxylate cycle
hsi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX17_03420
   00620 Pyruvate metabolism
    BOX17_03420
   00630 Glyoxylate and dicarboxylate metabolism
    BOX17_03420
  09102 Energy metabolism
   00680 Methane metabolism
    BOX17_03420
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BOX17_03420
Enzymes [BR:hsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BOX17_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: APE30084
UniProt: A0A1J0VDH1
LinkDB All DBs
Position
complement(760232..761206)
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGAAGQISYSLAFRIASGDMLGKDQPVILQLLEIPPAMDALNGVVMELNDC
AFPLVQDIVATDDANVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVRVLVVGNPANTNALIASCNAPDLDAGQFTAMMRLDHNRAKTQLAQKAGKHVTDVES
MVVWGNHSATQYPDLAHCKVDGKPALDLVDREWYENDFIPTVQQRGAAIIKARGASSAAS
AASAAIDHMRDWALGTDEVVSMGIPADGSYGVEPGIMYSYPVVCRNGQYEIVQGLEIDDF
SRGRMKATEDELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcccgtccgtattgccatcaccggtgctgccggccagatcagctactccctc
gccttccgcatcgcctccggcgacatgctgggcaaggaccagccggtcatcctgcagctg
ctggagatcccgccggccatggacgccctcaacggcgtggtgatggagctcaacgactgc
gccttcccgctggtgcaggacatcgtcgccaccgacgacgccaatgtcgccttcaaggat
gccgatttcgccctgctggtcggtgcccgtccgcgcggtcccggcatggagcgcaaggac
ctgctcgaggccaatgccgcgatcttctccgtgcagggcaaggcgctcaacgaccatgcc
agccgcgacgtccgcgtgctggtggtcggcaacccggccaacaccaacgccctgatcgcc
tcctgcaatgcgccggacctggacgcgggccagttcaccgcgatgatgcgtcttgaccac
aaccgcgccaagacccagctggcccagaaggctggcaagcacgtcaccgacgtcgagtcc
atggtggtgtggggcaaccacagtgcgacccagtacccggacctggcccactgcaaggtg
gacggcaagccggccctcgacctggtcgaccgcgagtggtacgagaacgacttcattccc
accgtgcagcagcgtggcgccgccatcatcaaggcgcgcggggcctcctctgcggcctcg
gcagcctccgcggccatcgaccacatgcgtgactgggcgctgggcaccgacgaggtggtg
agcatgggcatccccgccgacggcagctatggcgtcgagccgggcatcatgtactcctac
ccggtggtctgccgcaacggccagtacgagatcgtccagggcctggagatcgacgacttc
agccgcgggcgcatgaaggcgaccgaggacgagctgcgcgaggagcgcgccgccgtcgag
cacctgctgggctga

DBGET integrated database retrieval system