KEGG   Halomonas aestuarii: BOX17_06380
Entry
BOX17_06380       CDS       T04554                                 

Definition
(GenBank) oligopeptidase A
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
hsi  Halomonas aestuarii
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsi01002]
    BOX17_06380
Enzymes [BR:hsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     BOX17_06380
Peptidases and inhibitors [BR:hsi01002]
 Metallo peptidases
  Family M3
   BOX17_06380
SSDB
Motif
Pfam: Peptidase_M3 Peptidase_M50B
Other DBs
NCBI-ProteinID: APE30612
UniProt: A0A1J0VF04
LinkDB
Position
1403327..1405375
AA seq 682 aa
MSRNPLLDPHDLPPFDAIRPEHVVPAVEELLAENRAAIEALVARAEQAPPSWESLAAPLE
ALNDRLARAWSPVSHLNGTMNNPELREAYQACLGKLSDYSTWVGQHEGLFRAWQALRDGP
AWETLDEGQRRTVENALRDFRLAGVDLPAEQKQRYGEIKSRLSELSNTFSNQLLDATQAW
HLDLEDDGRLAGLPESALATLKANAEAKGLSGYRITLDFPSFFPVMTYAEDRELRREVYT
AFVTRASDQGPHAGEYDNAPVMEEILALRHELAELLGFTDYADYSLSTKMAESPEQVITF
LEDLAARAVPQAREEYAELAAYARDELGMATLDPWDVGFASEKLREARYAISDEQLRPYF
PAPQVVDGLFRVVERLYEVTFVEDEEAPRYHPDVRYFQILEQGAPIAGFYLDLYAREGKR
GGAWMDECRVRRLEEGEVQLPVAYLTCNFTRPVGDAPALLTHDEVTTLFHEFGHGLHHML
TRQTVADISGINGVAWDAVELPSQFMENFCWEREGLDLIAAHVDTGEPLPEDLFEKLLAA
KNFQSAMGMVRQLEFSLFDFRLHRERAAPSAAEVQALLDEVRDAVSVVPRAAFNRFQNGF
GHIFAGGYAAGYYSYKWAEVLSADAWSAFEEAGIFDPETGRRFRTEILERGGSRDAAELF
RAFRGREPSVEPLLRHCGIRAA
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgtcccgcaacccactgctcgatccccacgacctgccccccttcgatgcgatccggccc
gagcacgtggtgccggccgtggaggaactgctggcggagaaccgtgccgccatcgaggcg
ctcgtggcccgcgccgagcaggcgcccccgagctgggagagcctggccgcgccgctggag
gccctgaacgaccggctggcacgggcctggtcgccggtctcgcatctcaacggcaccatg
aacaatcccgagctgcgcgaggcctaccaggcctgcctgggcaagctctccgactacagc
acctgggtcggccagcacgagggactcttccgcgcctggcaggccctgcgtgatggcccc
gcctgggagaccctcgacgagggccagcgccgcaccgtggagaatgccctgcgggacttc
cgcctggcaggcgtcgacctgcccgccgagcagaagcagcgctacggcgagatcaagtcg
cgcctctccgagctctccaacaccttctccaaccagctgctggacgccacccaggcctgg
cacctggacctcgaggacgacggccggctggccgggctgcccgagagcgccctggcgacg
ctcaaggccaacgccgaggccaagggcctgtcgggctaccgcatcaccctggacttcccc
agcttcttcccggtgatgacctatgccgaggaccgcgagctgcgccgcgaggtctatacc
gccttcgtgacccgcgcctcggaccagggcccccatgccggcgagtacgacaatgccccg
gtgatggaggagatcctcgccctgcgtcacgagctcgccgaactgctgggcttcaccgac
tacgccgactactcgctgtccaccaagatggccgagtcgccggagcaggtgatcaccttc
ctcgaggacctggccgcgcgcgccgtgccccaggcccgcgaggagtacgcggagctggcc
gcctatgcccgcgacgagctgggcatggcgacgctcgacccctgggacgtgggcttcgcc
agcgagaagctccgcgaggcgcgctacgccatctccgacgagcagctgcgcccctacttt
cctgccccgcaggtggtggacgggctgttccgggtggtcgagcgcctctacgaggtcacc
ttcgtggaggacgaggaggcaccgcgctaccaccccgacgtgcgctacttccagatcctc
gagcagggcgcgcccatcgccggcttctacctcgacctctatgcccgcgagggcaagcgc
ggcggcgcctggatggacgagtgccgggtgcgccgcctggaggagggcgaggtccagctg
cccgtggcctacctgacctgcaacttcacgcgcccggtcggcgacgccccggccctgctg
acccacgacgaggtcaccaccctcttccacgagttcggccacggcctgcaccacatgctg
acccgccagaccgttgccgacatctccggcatcaatggcgtggcctgggacgccgtggag
ctgcccagccagttcatggagaacttctgctgggagcgcgagggcctggacctgatcgcc
gcccatgtggataccggcgagccgctccccgaggacctgttcgagaagctgctggcggcc
aagaacttccagtccgccatgggcatggtgcgccagctggaattctcgctgttcgacttc
cgcctgcaccgggagcgggccgccccctcggccgccgaggtccaggcgctgctcgacgag
gtgcgcgatgcggtctcggtggtgccgcgagccgccttcaatcgcttccagaacggcttc
gggcacatcttcgccggcggctatgcggcaggctactacagctacaagtgggccgaggtg
ctctcggcggatgcctggagcgccttcgaggaggccggcatcttcgaccccgagaccggt
cggcgcttccgcaccgagatcctcgagcgcggcggctcgcgggatgccgccgagctgttc
cgcgccttccgcggccgcgagcccagcgtcgagccgctgctgcgccactgcggcatccgg
gctgcctga

DBGET integrated database retrieval system