KEGG   Halomonas aestuarii: BOX17_07280Help
Entry
BOX17_07280       CDS       T04554                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hsi  Halomonas aestuarii
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BOX17_07280
Enzymes [BR:hsi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BOX17_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA HI0933_like Glutaredoxin K_oxygenase FAD_binding_2 FAD_binding_3 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APE30771
UniProt: A0A1J0VFF7
LinkDB All DBs
Position
complement(1600369..1601925)
Genome map
AA seq 518 aa AA seqDB search
MLDDNLKSQLKAYLEKVTQPFEIVASLDDGDKSRELHGLLTDIVGLTDKITLKLDGQDAR
TPSFALNRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKASDEVLEQIRSLEGEMRF
ETYFSLSCQNCPDVVQALNLMAIFNPNVHHVAIDGALFQDEVKQREIMSVPSVYLNGEPF
DQGRMGLEQILAKVDTGAASREAAKLNEKDAFDTLMIGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTMGIENLISVPRTEGPKLAAALEEHVKEYEVDIMNLQRAVKLVPATRPGG
EHEVQFESGASLRAKTLVLGTGARWREMGVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLIEFMDELRADAVLQKKLRSLPNVDILLGARTTEVNGDG
KRVNGLTFEERATGELHQVDLEGVFVQIGLVPNTEWLQDSPIELSERGEIVVDAHGMTSV
PGIFAAGDVTTVPYKQIVIAMGEGSKAALGAFDYLIRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaatctgaaaagccagctcaaagcctatctggaaaaggtcactcagccg
ttcgagatcgtcgcgtccctcgatgacggcgacaagtccagggaactgcacggtctgttg
accgacatcgtcggcctgaccgacaagatcaccctgaagctcgacggccaggatgcccgc
acgccctccttcgctctgaaccggcccggcgaggagaccggcgtggtcttcgccggcatc
cccatgggtcacgagttcacctcgctggtgctggcgctgctgcaggtcggcggccatccg
cccaaggcctccgacgaggtgctcgagcagatcaggagcctcgagggcgagatgcgcttc
gagacctacttctcgctctcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcgatcttcaacccgaacgttcaccacgtcgccatcgacggcgcgctcttccaggac
gaggtgaagcagcgcgagatcatgtcggtgcccagcgtctacctcaacggcgagcccttc
gaccagggccgcatgggcctggagcagatactcgccaaggtggacaccggcgccgccagc
cgcgaggccgcgaagctcaacgagaaggacgccttcgataccctgatgatcggcggcggg
cccgccggcgccgcggcggccgtctatgccgcgcgcaagggcatccgcaccggcgtggcc
gcggagcgcttcggcggccaggtcctcgacaccatggggatcgagaacctcatctccgtg
ccccgcaccgaggggcccaagctggccgcggccctggaggagcacgtcaaggagtacgag
gtcgatatcatgaacctgcagcgtgcggtcaagctggtgccggccacccggcccggcggc
gagcacgaggtgcagttcgagtccggcgccagcctgcgcgccaagaccctggtgctgggc
accggcgcccgctggcgcgagatgggcgtgcccggcgaggccgagtatcgcaacaagggc
gtggcctactgcccccactgcgacggcccgctcttcaagggcaagcgcgtggcggtgatc
ggtggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtgggccacgtg
accctgatcgagttcatggacgagttgcgcgccgatgcggtgctgcagaagaagctccgg
agcctgcccaacgtcgacatcctcctcggcgcccgcaccaccgaggtgaacggcgacggc
aagcgcgtcaacggcctgacctttgaagagcgtgccaccggcgagcttcaccaggtcgac
ctggaaggcgtcttcgtgcagatcggcctggtgcccaacaccgagtggctgcaggattcg
cccatcgagctctccgagcgtggcgagatcgtggtcgacgcccacggcatgacctcggtc
ccgggcatcttcgccgccggcgacgtgaccacggtgccctacaagcagatcgtcatcgcc
atgggcgaagggtccaaggccgctctcggcgccttcgattacctcatccgccagtga

DBGET integrated database retrieval system