KEGG   Halomonas aestuarii: BOX17_09880Help
Entry
BOX17_09880       CDS       T04554                                 

Definition
(GenBank) aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
hsi  Halomonas aestuarii
Pathway
hsi00020  Citrate cycle (TCA cycle)
hsi00630  Glyoxylate and dicarboxylate metabolism
hsi01100  Metabolic pathways
hsi01110  Biosynthesis of secondary metabolites
hsi01120  Microbial metabolism in diverse environments
hsi01130  Biosynthesis of antibiotics
hsi01200  Carbon metabolism
hsi01210  2-Oxocarboxylic acid metabolism
hsi01230  Biosynthesis of amino acids
Module
hsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
hsi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX17_09880
   00630 Glyoxylate and dicarboxylate metabolism
    BOX17_09880
Enzymes [BR:hsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     BOX17_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: APE31231
UniProt: A0A1J0VGU3
LinkDB All DBs
Position
complement(2134445..2137189)
Genome map
AA seq 914 aa AA seqDB search
MSNESLPDTLQTLDAGGTTYHYHSLPKAAEALGNIDRLPKTLKILLENQLRFADDESVAR
EDMQALVDWQQRGHSDREIGYRPARVLMQDFTGVPGVVDLASMRAAVESLGEDPARINPL
SPVDLVIDHSVMVDKFGNATAFKDNVAIEMERNHERYEFLRWGQQAFDNFRVVPPGTGIC
HQVNLEYLGKTVWSKEQDGKTLAYPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQ
PVSMLIPEVVGFKLTGKLREGITATDLVLTVTEMLRKKGVVGKFVEFYGDGLKDLPLADR
ATIANMAPEYGATCGFFPVDDETLTYMRLTGREDAQLALVEAYSKAQGLWREPGDEPVFT
DTLALDMTEVEASLAGPKRPQDRVALKDMSSAFARVMEDDGKPLSSTEKGKLMSEGGQTA
VGVEESYEHHDSQDVTLDGEAFRLNPGAVVIAAITSCTNTSNPSVMMAAGLLARKAREKG
LGTKPWVKTSLAPGSKVVTDYLAAGGVQDDLDALGFNLVGYGCTTCIGNSGPLAGPIEEA
IETGDLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGNVQLDLTREPLGTDRH
GQPVFLKDIWPSQAEIAEAVEQVNTEMFRKEYAEVFDGDEVWKAIEVPQSKVYQWSTDST
YIQHPPFFEGMGRTPDAIDDVKDARVLAMLGDSVTTDHISPAGSIKPDSPAGRYLQEHGV
KPVDFNSYGSRRGNHEVMMRGTFANVRIKNEMLDGVVGGETRHVPSGEQMAIYDAAMRYQ
QEGTPLVVIAGKEYGTGSSRDWAAKGTRLLGVRAVLAESYERIHRSNLIGMGVVPLQFPE
GESRKTLGLTGDETVSIEGLASLTPGGRVKVTIASDKGEKKIEALCRIDTANELEYYRHG
GILHYVLRNMIGSA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgagtccctaccggatactctgcagacgctggacgccggtggtacgacctac
cactaccacagcctgcccaaggccgccgaggcgctcggcaacatcgaccgactgcccaag
acgctgaagatcctgctggagaaccagctgcgcttcgccgatgacgagagcgtcgcccgc
gaggacatgcaggcgctggtcgactggcagcagcgggggcactccgatcgcgagatcggc
taccgcccggcccgggtgctgatgcaggacttcaccggcgtgccgggcgtcgtggacctg
gcctccatgcgcgccgcggtggagtcgctcggcgaggaccccgcgcgcatcaacccactg
tcgccggtggacctggtcatcgaccactcggtgatggtcgacaagttcggcaacgccacg
gcgttcaaggacaacgtcgccatcgagatggagcgcaaccacgagcgctacgagtttctg
cgctggggccagcaggcctttgacaacttccgcgtcgtgccccccggcaccggcatctgc
caccaggtcaacctggagtacctgggcaagaccgtctggtcgaaggagcaggacggcaag
accctggcctatccggacaccctggtcggcacagactcccacaccaccatgatcaacggc
ctgggcgtgctcggctggggcgtgggcggcatcgaggccgaggccgccatgctcggccag
ccggtctcgatgctgattcccgaggtcgtcggcttcaagctcaccggcaagctgcgcgag
ggcatcaccgccaccgacctggtgctgaccgtcaccgagatgctgcgcaagaagggcgtg
gtgggcaagttcgtcgagttctacggcgacggcctcaaggacctgcccctggccgaccgg
gccaccatcgccaacatggcgccggagtacggggcgacctgcggcttcttcccggtggac
gacgagaccctcacctacatgcgccttaccggccgcgaagacgcccagctggcgctggtg
gaggcctacagcaaggcccaggggctgtggcgcgagcccggcgacgagccggtcttcact
gacaccctggcgctggacatgaccgaggtcgaggcgagcctggccggccccaagcggccc
caggaccgggtggcgctcaaggacatgagctcggccttcgcgcgggtcatggaggacgac
ggcaagccgctctccagcaccgagaagggcaagctgatgtccgagggcggccagaccgcc
gtgggcgtcgaggagagctacgagcaccacgacagtcaggacgtcaccctggacggcgag
gccttccggctgaatcccggcgcggtggtgatcgccgccatcacctcctgcaccaacacc
tccaaccccagcgtgatgatggccgctggcctgctggcacggaaggcccgcgagaaggga
ctcggcaccaagccctgggtcaagacctccctggcgccgggctccaaggtggtcaccgac
tacctggccgccggcggcgtgcaggatgacctcgatgccctgggcttcaacctggtcggc
tacggctgcaccacctgcatcggcaactccggcccgctggcgggcccgatcgaggaggcc
atcgagacgggcgacctcaccgtggcctccgtgctctcgggcaaccgcaacttcgagggc
cgagtgcacccgctggtcaagaccaactggctggcctcgccgcccctggtggtggcctat
gccctggccggcaacgtccagctcgacctgacccgtgagcccctgggcacggaccggcac
ggccagccggtcttcctcaaggacatctggcccagccaggctgagatcgccgaggccgtg
gagcaggtcaacaccgagatgttccgcaaggagtacgccgaggtcttcgacggcgacgag
gtgtggaaggcgatcgaggtgccccagagcaaggtgtaccagtggtcgacggactccacc
tacatccagcatccgcccttcttcgagggcatgggccgcacgccggacgccatcgatgac
gtcaaggacgcccgggtgctggccatgctgggggactcggtgaccaccgaccacatctcc
ccggccggctccatcaagcccgacagccccgccggacgctacctgcaggagcacggcgtc
aagccggtggacttcaactcctacggctcacggcgcggcaaccacgaggtgatgatgcgc
ggcaccttcgccaacgtgcgcatcaagaacgagatgctcgacggcgtggtcggcggcgag
acccgccacgtgccctccggcgagcagatggccatctacgatgccgccatgcgctaccag
caggagggcaccccgctggtggtgatcgccggcaaggagtacggcaccggctccagccgc
gactgggcggccaagggcacgcgcctgctcggggtccgcgcggtgctggccgagtcctac
gagcgcatccaccgctccaacctcatcgggatgggcgtggtgccgctgcagttcccggag
ggcgagagccgcaagacgctgggcctgaccggcgatgagacggtctccatcgaggggctc
gcctcgctcaccccggggggccgggtcaaggtgaccatcgcctccgacaagggcgagaag
aagatcgaggcgctctgccggatcgataccgccaacgaactggagtactaccgccacggc
ggcatcctccactatgtgctgcgcaacatgatcgggtcggcctga

DBGET integrated database retrieval system