KEGG   Halobacterium salinarum: OE_2298FHelp
Entry
OE_2298F          CDS       T00662                                 

Gene name
ligB
Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hsl  Halobacterium salinarum
Pathway
hsl03030  DNA replication
hsl03410  Base excision repair
hsl03420  Nucleotide excision repair
hsl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    OE_2298F (ligB)
   03410 Base excision repair
    OE_2298F (ligB)
   03420 Nucleotide excision repair
    OE_2298F (ligB)
   03430 Mismatch repair
    OE_2298F (ligB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsl03032]
    OE_2298F (ligB)
   03400 DNA repair and recombination proteins [BR:hsl03400]
    OE_2298F (ligB)
Enzymes [BR:hsl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OE_2298F (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     OE_2298F (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     OE_2298F (ligB)
DNA replication proteins [BR:hsl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    OE_2298F (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     OE_2298F (ligB)
DNA repair and recombination proteins [BR:hsl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     OE_2298F (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     OE_2298F (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     OE_2298F (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CAP13594
UniProt: B0R4C9
LinkDB All DBs
Position
656396..658081
Genome map
AA seq 561 aa AA seqDB search
MKFGSFATFAADIEATDADLDVVALVAELFDAADSDLDVVARFVQGRVFPAHSETKLDIG
PQLCYTALSRAAGRNVDADDIEARLAETGDIGAVAGSLDLGGQTGLAAFGGGDDHADGLT
VSGVADELAALAAAAGDGSQSEKVTLLFGLFNQCTSREARYLARLVLGEMRIGVGEGAVR
DAIAEAFDVPTAAVQRALQVSNDYGLVAETARDSGTDALDAMGLEVGRPVQAMLAQAGTV
TDALDEWHEAAVETKFDGARVQVHYDGDDVVLYSRNMENVTGALPELVEFVENNVTAPVI
IDGEAVAADEDGDPLPFQEILKRFRRKHDVAAMREEISVELHAFDCLHAPSADGGEDLLD
APFSDRHRRLRSVVDDASAVSEVLVTDDADEIAAFEATALEGGHEGIMLKNPAAPYTPGD
RGKDWLKRKPDVETLDLVVTGAEWGEGRRASVLGTFLLSARDAAGDGFETIGKVATGLTD
EELAALSDRLEPHVRSEDGQTVDIEPAVVLEVGYEEIQASPTYSSGYALRFPRFVSVRED
KTPTTADTIERVERLAAQQQQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcggctcgttcgccacgttcgctgccgacatcgaagccaccgacgccgacctc
gacgtggtggcgctggtcgcggagctcttcgacgcggccgacagcgacctcgatgtcgtc
gcgcggttcgtccagggacgcgtgttccccgcccactccgagacgaaactcgacatcggg
ccacagctctgttacacggcgctctcgcgggctgcgggccggaacgtcgacgcggacgac
atcgaggcacgactggccgaaaccggcgacatcggggccgtcgccggcagcctggacctc
ggcggacagaccggactcgcggcgttcgggggcggcgacgaccacgccgacggactcact
gtcagcggtgttgcggacgaactcgcggccctggcggccgccgccggcgacggcagtcag
tccgagaaagtcacgctcctgttcgggctgttcaaccagtgcaccagccgggaagcccga
tacctcgcgcggctggtgttgggtgagatgcgcatcggcgtcggcgagggggccgtccgg
gatgccatcgctgaggcgttcgacgtgccgactgcggccgtgcagcgcgccctccaggtg
tcgaacgactacggcctcgtggccgaaaccgcacgcgacagcggcaccgacgcgctggac
gcgatggggctggaggtgggccgccccgtgcaggcgatgctcgcgcaggccggcacggtc
acggacgccctcgacgagtggcacgaggccgccgtcgaaacgaaattcgacggcgcacgc
gtgcaggtgcactacgacggggacgacgtggtgctgtactcgcggaacatggagaacgtg
acgggggcgctcccggagctcgtggagttcgtcgagaacaacgtcacggcccccgtgatc
atagacggtgaggccgtcgcggccgacgaggacggcgacccactgccgttccaggagatc
ctcaagcggttccgccgcaagcacgacgtcgccgcgatgcgcgaggagatcagcgtggag
ctgcacgcgttcgactgcctgcacgcgccgagcgccgacggcggcgaggacctactggac
gcgccgttttccgaccgccaccggcgactgcgctcggtggtcgacgacgcgtcggcggtc
tcggaggtgctcgtgaccgacgacgccgacgagatcgcggccttcgaggcgaccgcgctg
gagggcggccacgagggcatcatgctgaagaacccggccgccccgtacacgcccggcgac
cgcgggaaagactggctgaagcgcaagcccgacgtggagacgctggatctggtcgtgacc
ggcgcggagtggggggaaggccgccgcgcgtcagtgctggggacgttcctgttgtccgcg
cgggacgccgccggcgacggcttcgagaccatcgggaaggtcgccaccgggctgacagac
gaggagcttgcggccctcagcgaccgcctggagccacacgtccgcagcgaggacggccag
acggtcgacatcgagccggcggtggttctcgaagtcggctacgaggagatccaggcgtcg
ccgacgtactcctcggggtacgcgttgcggttcccgcggttcgtctccgtccgcgaggac
aaaaccccgacgacggccgacaccatcgagcgcgtcgagcggctcgccgcccagcaacag
cagtga

DBGET integrated database retrieval system