KEGG   Halobacterium salinarum: OE_2553RHelp
Entry
OE_2553R          CDS       T00662                                 

Gene name
glpA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
Organism
hsl  Halobacterium salinarum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_2 FAD_binding_3 Pyr_redox NAD_binding_7 HI0933_like NAD_binding_9 NAD_binding_8 GIDA ApbA Pyr_redox_3 FAD_oxidored 3HCDH_N Thi4 ThiF
Motif
Other DBs
NCBI-ProteinID: CAP13749
UniProt: B0R4T4
LinkDB All DBs
Position
complement(811534..812745)
Genome map
AA seq 403 aa AA seqDB search
MTHQTDVLVVGGGATGVGVARDLALRGVDVTLVDRGGLGSGTTGRSHGLLHSGARYADST
PADARECIRENEVLRDIAGACIRDTDGFFVQHARDDPAYFDTKVAACRDADIPVSVIDGA
TARAREPALTPAAERVAVVPDGVVLPSRLVAATAADARDHGATIRLHEPITALTTDAGRV
TGARTADGTTLSATHVVNAAGAWAGDLAATAGVDVDMHPASGVMVTVETPETDTVFNRCR
PAADGDIVVPHGSTAVLGTTSVDVDDADEFATPDAAVERVIDECSALLPAASDAPIRTTY
WGVRPLYSPSDYGDDARAISRGFYVLDHADRDDTAGLTTVVGGKLTTHRLMAEATADLVA
DRLGVTEPSRTANEPLPGHDDPERLDALVDTFDAASPADADAR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaccagacagacgtgctcgtggtcggcggcggcgcaaccggggtcggcgtcgcc
cgcgacctcgcgctccgcggcgtcgacgtgaccctcgtcgaccgcggcggcctcgggagc
ggcaccaccggccgctcgcacggtctcctgcacagcggtgcccggtacgccgactcgacg
ccggccgacgcccgcgaatgcatccgggaaaacgaagtcctccgggacatcgccggcgcg
tgcatccgggacaccgacggcttcttcgtccagcacgcccgcgacgaccccgcctacttc
gacacgaaagtcgcggcctgccgtgacgccgacatccccgtgtctgtcatcgacggtgcc
actgccagagcccgcgaaccagccctcacgcccgccgccgagcgcgtcgcggtcgttccc
gacggcgtcgtcttgccgtcccgactggtcgctgcgaccgccgcggacgcccgcgaccac
ggcgcgacgatccgcctccacgagccgatcacggcgctcaccacggacgccggccgcgtc
accggcgccagaaccgccgacgggacgacgctgtcggccacccacgtggtgaacgcggcc
ggcgcgtgggccggcgacctcgccgcaaccgccggcgtcgacgtcgatatgcatcccgcc
agcggagtcatggtgaccgtcgaaacgccggagaccgacacggtgttcaaccgctgccgg
cccgccgctgacggcgacatcgtggtgccacacggctccaccgcggtcctgggcaccacc
agcgtcgacgtcgacgatgccgacgagttcgccacccccgacgccgccgtcgagcgcgtc
atcgacgaatgcagcgccctgctgccggcggccagcgacgccccgatccggaccacctac
tggggcgtccgcccgctgtacagcccaagcgactacggcgacgacgcccgcgcgatctcc
cgcgggttctacgtgctcgatcacgccgaccgcgacgacaccgccggactcacgacagtc
gtcggcgggaagctcaccacccaccggctgatggcggaggcgaccgcggatctcgtggcc
gaccggctcggcgtcactgagcccagccggaccgcgaacgaaccgctccccggccacgac
gaccccgaacgactcgacgcgctcgtcgatacgttcgatgccgccagtccggccgacgcc
gacgcgcgctga

DBGET integrated database retrieval system