KEGG   Histophilus somni 2336: HSM_0411Help
Entry
HSM_0411          CDS       T00673                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00520  Amino sugar and nucleotide sugar metabolism
hsm01100  Metabolic pathways
hsm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HSM_0411
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HSM_0411
Enzymes [BR:hsm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HSM_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACA32054
UniProt: B0URH6
LinkDB All DBs
Position
complement(475909..477669)
Genome map
AA seq 586 aa AA seqDB search
MSVDLTKKPYYLKDEDIQWVKNTIANMTLEEKIGQLFVNMGSSRSEEYLTDVLNRYHIGA
VRYNPGPAEEVYDQNYILQTKSKIPLLIAANTEAGGNGACSDGTEIGLQVKIGATDDAKY
AYEMGRVAGIEAAAIGCNWSFAPIVDISYNWRNPIISNRVFGSNPEKVLEMSLAYMKGIQ
ESGIAPAAKHFPGDGVDERDQHLSFSVNSFSCEEWDKTFGKVYQGLIDAGLPSLMAGHIH
LPAYEQHFNPNLAYEDCLPATLSKPILTDLLRGKLGFNGVVVTDASHMVAMTSAMKRSEM
LPTAIAAGCDLFLFFNDPDEDFGYMMEGYKNGIITEERLHDALTRILGLKAKLGLHNRPR
ETLLEPKEQALAKIGLPEHKAIFRDVADKAITLVKHKQDIFPINVERFPRILLVNVKGTD
GGFGKMVAGSQRSATEILKEKLEEKGFTVSIYTSPMDNILKMSDEEQVKTIRNEYSQKRP
ITTLTDHYDLIINVANVQMSTVQRIVWQATKGTPDIPFYVHEVPTIFVSVQCPFHLVDVP
QVKTYINAYDGKEPTIELLVEKLMGNSEFKGISPVDAFCGYKDTRI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgatttaacgaaaaaaccttattacttaaaagatgaagatattcaatgggta
aaaaacactatagccaatatgacgttggaagaaaaaatcggtcagctttttgtgaatatg
ggttcaagcagatccgaggaatatctcactgatgttttaaaccgttaccatattggtgcg
gtacgttataatcccggtcctgctgaggaggtttatgaccaaaactatattctacaaact
aaaagtaaaattcctctcttaattgcagcgaatacagaagctggtggtaatggtgcttgc
agtgatggaacagaaattggtttacaagtcaaaatcggtgcaaccgatgatgctaaatat
gcttatgaaatggggcgtgtagctggtattgaagcagcagctatcggttgtaactggagt
tttgctcctatcgttgatattagttataactggcgaaacccaattatttctaatcgagta
tttggttcaaatccagagaaagtactagaaatgtccttggcttatatgaaaggtattcaa
gaaagtggtattgccccggctgcaaaacatttccctggtgatggagtggatgaaagagat
cagcatctttcttttagtgtaaacagttttagttgcgaagagtgggacaaaactttcggc
aaagtttatcaaggcttaattgatgccggtttaccatcgttgatggcaggtcatatacac
ttacctgcttacgagcagcatttcaatccaaatttagcttatgaggactgcctaccagcg
acactttcaaaaccaattttaacagacttattacgaggtaaattaggtttcaacggtgtt
gttgttactgatgccagccatatggtagcaatgacttcagcaatgaagcgtagcgaaatg
ctaccgactgctatcgctgcaggttgtgatttattccttttctttaacgatcctgatgaa
gatttcggttatatgatggaaggttataaaaacggcattattaccgaagaacgccttcat
gatgcccttactcgtattctagggttaaaagcaaaattaggcttacacaatcgcccaaga
gaaacattgcttgaaccaaaagaacaagcattagcaaaaataggacttccagaacataaa
gcaattttccgtgatgttgcagataaagcaattaccttagttaaacataaacaagatatt
ttcccaattaatgttgaacgtttccctagaatcttacttgtaaatgttaaaggtacagat
ggtggcttcggtaaaatggttgcaggtagtcaacgcagtgcaacagaaatcttaaaagaa
aaactggaagaaaaaggatttacagtttctatttatacatcaccgatggataatattctc
aagatgtcggacgaagaacaggtcaaaactattcgtaatgaatactcccaaaaacgccca
attacgacattaacggatcattatgatctgattatcaatgttgcgaatgtgcaaatgagt
acagttcaacgtatcgtatggcaagcgaccaaaggaacgcctgatattccattctatgta
catgaagtacctacaattttcgtttccgttcaatgcccattccatttagttgatgttcct
caggtaaaaacttacatcaatgcctatgacggcaaagaaccaaccatagaattactggta
gaaaaattaatgggtaattccgagtttaaaggtattagcccagttgatgctttctgtggt
tataaagacacccgtatttaa

DBGET integrated database retrieval system