KEGG   Histophilus somni 2336: HSM_0630Help
Entry
HSM_0630          CDS       T00673                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00473  D-Alanine metabolism
hsm00550  Peptidoglycan biosynthesis
hsm01100  Metabolic pathways
hsm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HSM_0630
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HSM_0630
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HSM_0630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsm01011]
    HSM_0630
Enzymes [BR:hsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HSM_0630
Peptidoglycan biosynthesis and degradation proteins [BR:hsm01011]
 Precursor biosynthesis
  Amino acid ligase
   HSM_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATP-grasp ATPgrasp_ST TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: ACA32286
UniProt: B0US69
LinkDB All DBs
Position
731325..732251
Genome map
AA seq 308 aa AA seqDB search
MAKPLKQQKIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPIDPKEYPVAMLKEQGF
DRVFNILHGRGGEDGTIQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADME
VVTRTSFSQLNPQVVVEKLGLPLMVKPSLEGSSVGLTKVNAIDDLKSAVEFALQYDETVL
IEEWLSGDELTVPVLGNEVLPSIKIVPQGEFYDYEAKYIADNTQYFCPSGLTEEREQELR
QLVKQAYDVVGCRGWSRIDVMLDGEGKFRLVEVNTNPGMTSHSLFPKSAATVGYSFEQLV
VKILELSL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccattaaaacaacaaaagatcgctgtcttattaggggggacttcagctgaa
cgtgaagtgtcgttaaactcaggaaatgcggtcttaacagcgttacgtaatcagggtttt
gatgctcacccaatcgatccaaaagaatatccggttgctatgttgaaagaacagggcttt
gatcgagttttcaatattttacatgggcgtggcggtgaagatggtacgatacaaggatta
ttagagcaaataggcttaccctatacgggttgtggcgtaatggcatctgctttaacaatg
gataaaatgcggactaaaatgttgtggaaagcattcgggttacctgttgcagatatggaa
gtcgttactcgcactagtttttcgcagttaaatccgcaagtagttgtagaaaaattgggc
ttgcctttaatggttaaaccttctttggaaggttcaagtgtcggattgacaaaagttaac
gctattgatgatctaaaaagtgcggtggaatttgcacttcaatatgatgaaaccgtactg
attgaagaatggctttccggtgatgaattaacggttccggtattaggtaacgaagtttta
ccttcgattaaaattgtaccccaaggggaattttatgattatgaagcaaaatatattgcc
gataatacgcagtatttttgcccctcaggattaacggaagagcgtgaacaagagcttcgt
caattagtcaaacaagcttatgatgttgtgggttgcaggggatggagccgtattgatgtc
atgctggacggcgagggtaaattccgcttagtggaagtcaatacaaatccgggaatgaca
agtcatagcttatttccaaaatcagctgcaactgttggttattctttcgagcaattggtc
gtcaaaattttggagctaagtctttaa

DBGET integrated database retrieval system