KEGG   Histophilus somni 2336: HSM_0735Help
Entry
HSM_0735          CDS       T00673                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00240  Pyrimidine metabolism
hsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HSM_0735
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HSM_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 RNase_E_G
Motif
Other DBs
NCBI-ProteinID: ACA32402
UniProt: B0USH4
LinkDB All DBs
Position
complement(844699..845286)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSDYNYRERNMNTLVYTTAIDDRFGKGKVSSRIGIHRQAN
LFHKDTDLFTEIALHIKQQKLHCILIDEAQFLTKAQVYQLSNVVDELNIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGKAVKDGEQIQIGGNDSYMS
VCRKHYKEILYSSNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactatatttttattattccacgatgaatgcggggaaatctacaaccttatta
caatcggattataactatcgtgaacgtaacatgaatacgttagtttatacaactgccatc
gacgatcgttttggtaaaggtaaagtgagttcacgtattggcattcatagacaagcgaat
ttatttcataaagacactgatctttttactgaaatagcactgcatattaagcaacaaaaa
ttacattgtattttaattgatgaagctcagtttttaacgaaagcacaagtctatcaacta
agcaatgtggtagatgaactcaatattccggtattatgctatggtctgcgtacagatttc
caagcagaattattcgaaggaagcaaatatctgttggcttgggcagatcaacttgaagaa
ttgaaaactatttgttactgcggacgtaaagctaattttgttttacgcttaaatgaacaa
ggtaaagcagtcaaagacggtgagcaaattcaaattggcggaaatgatagttatatgtcg
gtatgccgtaaacattataaagaaatactttattcttctaatgaataa

DBGET integrated database retrieval system