KEGG   Histophilus somni 2336: HSM_1035
Entry
HSM_1035          CDS       T00673                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
hsm  Histophilus somni 2336
Pathway
hsm00052  Galactose metabolism
hsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HSM_1035
Enzymes [BR:hsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     HSM_1035
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Pyr_redox 2-Hacid_dh_C Pyr_redox_2 Shikimate_DH ADH_zinc_N_2 UDPG_MGDP_dh_N ELFV_dehydrog ThiF HI0933_like 3HCDH_N Pyr_redox_3 NAD_binding_7 FAD_binding_3 ssDNA_TraI_N
Other DBs
NCBI-ProteinID: ACA30748
UniProt: B0UTB6
LinkDB
Position
1193352..1194395
AA seq 347 aa
MKAIVLESNRNMAICDIPKPLVEDPDDVLVKVHYSGLCGSDIPRIFHHGTHFYPIVLGHE
FSATVEEVGSDVTELDKGDLVSCAPLQPCFKCDECNRGFYSLCKNYNFIGSRRFGANSEY
LCVKKSNLVKLPQGSDTLQASFIEPITVGLHAIHLAGGCKGKNVVIVGAGTIGLLAAQST
KALGANSVSVIDINQEKLVLAKTLGADYVFNSMDLKADEILACLDGNRFDQLILETAGVP
KTVELSIQIAGPRAQVVLVGTLHHDLNLDQKEFGLILRKELIIFGSWMNYSKPWPGVEWR
EAVNLIAENKICFEPLISSINTIEDYVEEVKSLDGKPMNGKLVLKFD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaagctattgttttagaatctaaccgtaatatggctatttgtgatattcctaagcct
ttagtcgaagaccctgatgatgtgttggtaaaagtgcattactccggactatgtggttcc
gatattccaaggatttttcatcatggtactcacttctatcctattgttttaggtcacgaa
tttagtgctacagtagaagaagtaggctcagatgtaacggaattggataagggagattta
gttagctgtgctcctctccagccctgttttaaatgtgatgaatgtaatagagggttttac
tctttatgtaaaaactacaattttatcggttcacgccgcttcggtgctaactcagagtat
ctttgtgtgaaaaagagtaatttggtgaagttacctcaaggaagtgacacattgcaagca
tcttttattgagcctatcactgttggattgcatgctattcatcttgcaggaggctgtaaa
ggtaaaaatgtggttatagttggagcaggtactatcgggttactggcagctcaatctaca
aaagcattaggggcaaattcagttagtgtgattgacatcaaccaagaaaaattggtgttg
gcaaaaacattaggtgcagattacgtatttaattcaatggatttgaaagctgacgaaatt
ctagcctgtttagatggtaatcgatttgatcaactaattttagaaacagcgggggtaccg
aaaactgttgaactttccattcaaattgctggacctagagctcaagtcgtattagttgga
acactacaccacgacctaaatctcgatcaaaaagaatttggactgattttacgcaaagaa
cttatcatttttggttcttggatgaattactccaaaccttggccgggagtcgaatggcga
gaagcagttaatcttattgcagaaaataaaatctgctttgaaccgcttatctcgtcgatt
aacactattgaagattatgtggaagaagtgaaatccttagacggtaaaccgatgaatgga
aaattggtattaaaattcgactaa

DBGET integrated database retrieval system