KEGG   Histophilus somni 2336: HSM_1542Help
Entry
HSM_1542          CDS       T00673                                 

Definition
(GenBank) YadA domain protein
  KO
K21449  trimeric autotransporter adhesin
Organism
hsm  Histophilus somni 2336
Brite
KEGG Orthology (KO) [BR:hsm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsm02000]
    HSM_1542
Transporters [BR:hsm02000]
 Other Transporters
  Pores ion channels [TC:1]
   HSM_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_stalk YadA_anchor YadA_head ESPR
Motif
Other DBs
NCBI-ProteinID: ACA31299
UniProt: B0UUR9
LinkDB All DBs
Position
complement(1768676..1775833)
Genome map
AA seq 2385 aa AA seqDB search
MNKIFKTKYDITTGQCKAVSELASNRQIASSSESKPKCGVFFGVFGAFKLAPLALALSVV
LPVEVLGQGFSPGVTGLQDGEAKDVQNMMKTGIKGEGFIDVDVGSFTCSKQGNGAGGGFG
ASNNQGIHNCSSNPIKIKLKDDITQKITKATELSDLFSRGGQELAPSSAEVNVGSDSIRI
RWKDAGAGENKNVINVGSGSTETLLKHVAAGKVQNGSTDAVNGGQLYSVIEAFGKLGSEV
LGAQVWLDGESDGGKRFGKSTFRPVQSNGYTRKSQTTFREAIQDTIEAINQGMTFKVGGN
GSGSSNNNTIKRQLGQSLTFKGDDYLTLSTEGSSGKDTIKLAVNATDSINSTSGGNSNGN
DKKLTTVKAVRDYVNSKITSGGGSGGSSTGTQSLHYLSVNDGTNGAGSGSSGSSGTKGNY
NNDGAKMEGAIAIGVGAEATEKYAIALGYEAKSKAEQAIVIGKDLNVDVKHSVLLGSGIT
VTQGSKEKQDAVVAVGNGVTFNNAKGSIAISAVNEGDGSDHTKLDNAEWSLAIGNKTKIN
SGTDIVALGNNINVNKANGGDEKSANSGLVIIGNKANAENAKYSVVIGQDAKSQAQSAVV
LGKGANVQASATGAVAIGEGASVSTAAGDSIALGRNSKATTRKLAPTGLTSTTGANDITI
SWSSAGAGANKSVLSIGDSGKERIITNVAAGTVQSGSTDAINGGQLYSVIDVFANLGINV
LGAEKADTGTDGFKKTTFKAVSYNGNETNARKSTFREAIEDTITAINKGLKFAGDTGGEQ
SLKLGDTLNIKGKEDSSNGNHKNITTTSSGSNLTIALSDTLKGINSVGKDNNNILSFSNG
SNSTSTATLKVGGTDLTFTQTGTNGNSKVKISGVADGSDQNDAVNFKQLEAAKLHYISVR
NDTAASGTTSNRNDNFDNDGAKAQNSIAIGHSAKVENGNSHDSVAIGYQSNVTNAKWSTA
VGAETQVKSIQSLALGYQAKVLENSDASIAIGVSGETKIINSKWSTALGNKIAITGSDNN
ILALGSNISVGTNNANLIIIGNGENGGSNGTITNAKNSVIIGKHAISQAESAVVIGKDAT
VQASAIGAVAIGEGASVSTNAGDSIALGKGSKAEDKKQAFKTQELSVNGSYSLLFKWENA
GTSASDSDKKSVLSIGDMGRERVIRHVAAGEIRDGSTDAINGGQLKGVIDVFGYLGTDVL
GAEKAETNKAGFKQTTFTKLKDKNGAETNPASTTFKDAITKNIEKINEGLKFKVENGTSA
GGSAGNSTEMTRQLGATVTFKGGKHLKATIDSSKGEISFEAESTDTINDTQQNSGGSSGS
SSNKLVTETAVKTYITQKLQNVGGTLQLEGDNTQNGSTPANPVGKVELNKHKLKITGESD
FIKTEVTQDKPTVTIKLADQVKKKLEVITVNGNGDNSFALGKGSEIVKKKTAPSGTTQNT
GQSEVTISWKNAGASADTMEGNKKEVVSVGSTGSERIITHVAAGEVRDGSTDAINGGQLY
NVIQVFGKLGTEVLGAEKNDRGDGFKKTTFTALKDTSGGNQATKDTFKDAINANISKINE
GLKFAVETGGGAQSSMASGNGPLTRQLGSTLTFGGDSYLTPSLDNSGGKITFKLKVATSI
SDTNSGSTTDQNDNKLVTASAVKEYLKNQLNSLTLKIEADNSNTAQAQAGGQAQSAAPST
PSSSGQSQSSNGKVQGAVKIQSQALQVLGTTDEIETKVEDKQQKVTIKLADQVKKKLDVI
TVNGKDGDNSFALGDGSQIVNKKTAPSGTIQNVGGNDIKISWSAGVGANKEVISVGKKDA
ERIITYVAAGEVKDTSTDAVNGGQLYNVIQVFGKLGTDVLGAEKDDSGDGFKKTTFTALN
KEDGTKNKATTTFKEAIDESIKTINKGLIFEVDDGTTTTATTTAPQTGGTSTNKMTRQLG
ATIKFKGDDYIKPSIDADTGTISFKIEATEEIKENGSADGSSGNSSAEDKKLTTAKAVKD
FVNSKIKTITDQQTEADKIAVKYDDEHKKSITLGGKPQNGGKAHDPVAIKNLKSALGIDN
DSMKGKSESEKQGKSLDLVKKLVSNGISSQQGQKMTEQQDLHQAANLADLKAVAQAGLRF
KGNQGDDVVRKISDTLTIKGEEETQNGQATSSFSSAAGNIKVETNTAKDGLEIKLSDTLK
NMKAFETKEEGGKKATLNSEGLKVVNNKNGNGKDISATYGADNIMLEDKKTGNKATITAE
SLTFADNATTQNQQNPKMPKAVLNKNGLTVTGANGEIKIDGEKGIITVPDIKPTTSGSAV
VNKKYVDTLQRQTDQKLSNLNNKLDMSNKELRAGIAGALATSGLPMSSVPGKSMFAASAG
SYKGQSAVALGYSRVSDNGKITLRLQGTRSSTGDVGGSVGVGYQW
NT seq 7158 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatcttcaaaaccaaatatgatattacaacaggtcaatgtaaagccgtttcc
gagttggcaagtaatcgccaaatagcgagcagttcggagagtaagccgaagtgcggtgtg
tttttcggtgttttcggggcgtttaaactcgcaccgctggcgttagcgttgtcggtggtg
ttgccggtggaggttttgggacaaggtttttcccccggtgttacaggattacaagatggt
gaagcgaaagatgtccaaaacatgatgaaaacggggataaagggagaaggttttatcgat
gtagatgtaggatcatttacttgtagtaaacaaggcaatggagcaggagggggatttggg
gcttcaaacaatcaaggaatacacaattgttcaagtaaccccatcaaaatcaaactcaaa
gacgatataacccaaaaaatcaccaaagccacggagttaagtgatttattttcgagaggg
ggtcaagaattagcccctagtagtgcagaggtgaatgttggttcggattctatacgaatt
agatggaaagacgcaggtgctggtgaaaataaaaacgttattaatgtaggaagcggtagc
accgaaaccctactaaaacatgtcgctgcaggtaaggtgcaaaatggctcaaccgatgcg
gtaaatggcggacaattatatagcgtgattgaagcctttgggaaattaggctcagaggtg
ttaggtgcacaagtttggcttgatggagaaagtgatggtggaaaacgtttcggaaaatca
acgtttaggccagttcaaagtaatggatatacaagaaaaagtcaaaccacgtttagagaa
gctattcaagatactattgaagccataaaccaaggaatgacctttaaagttgggggaaat
ggaagtggtagcagtaacaacaatactatcaaaagacaactcggacaatcattgaccttt
aaaggcgacgattatctgactttaagcactgaaggtagtagtggtaaggacacaattaag
cttgccgtcaatgcgactgattcaattaacagcacatcaggcggtaacagcaacggcaat
gacaaaaaattaacgactgtaaaagcagttagagactatgtaaatagtaaaattacaagc
ggtggcggaagtggcggaagcagtactggtacgcaatctttgcattatttgtcggtgaat
gatggtacaaacggtgcaggtagcggttctagcggttcgagtggcacaaaaggcaactac
aataacgatggagcaaagatggagggtgctatcgctatcggtgtgggggcggaagcgacc
gaaaaatatgccatcgcccttgggtacgaagcgaaatcaaaagctgaacaagcgattgta
attggtaaggacttgaatgttgatgtaaaacattccgtgttgttaggctcaggtattacg
gttacacaaggcagtaaagaaaaacaagatgctgttgtcgctgttggtaacggcgttaca
ttcaacaatgcaaaaggctcaatcgctatcagtgcggttaatgaaggagatggttctgac
catacaaaattagataatgccgaatggtcattagccatcggtaataaaaccaaaatcaac
agcggtacagatatcgtggcgttggggaataatattaacgtaaataaagcgaatggtggc
gatgaaaagagtgcaaacagtggtttagtgattattggtaataaggcaaacgctgaaaat
gctaaatattctgtggtgattggtcaagatgcaaaatctcaagcacaaagtgcggtggta
ctcggtaaaggtgcgaatgttcaagcaagtgcaacaggtgcggtagcgattggggagggt
gcgtctgtatccaccgccgctggcgattctattgcgttggggagaaattctaaggcgacc
actagaaagctagcaccaaccggtcttacatctactactggagctaatgatataacaatt
tcttggagtagtgccggagcaggagctaataagtccgttttaagtattggggacagcggt
aaggaacgaataataacgaatgttgccgccggaacagtgcaatcaggttcaaccgatgct
atcaatggcgggcaactttatagcgtaattgatgtatttgctaatttagggataaatgta
ctcggtgccgaaaaagcggatactggaacagatggttttaaaaagactacttttaaagct
gtttcatataatggaaatgaaactaatgctaggaagtctacttttagagaagcaattgaa
gataccatcacagcgataaacaaaggacttaaatttgctggagatactggcggagaacaa
tctctaaaattaggagacactttaaatattaaaggaaaagaagatagttcaaatggcaac
cataaaaatattaccactacgtcttctggaagtaatttaacaatagcacttagcgatacc
ttaaaaggtattaacagcgtaggaaaagataataataacattctatcatttagtaatggg
tcaaatagtacatcaactgccacgttaaaagtcggtgggactgatttaacatttacacaa
accggaactaatggaaatagtaaagtcaaaatttcaggcgttgctgatggctcagatcaa
aacgatgccgtaaactttaaacaacttgaagcggcgaaattgcattatatttcggtaaga
aatgacaccgccgcttccggcacaacaagtaacagaaacgacaattttgataacgacgga
gcaaaagcccaaaattctattgcgattggtcatagtgcaaaagtagaaaatggtaattca
cacgattccgttgctatcggttatcaatcaaatgtaacaaatgccaaatggtcaactgct
gtaggtgcagaaactcaggttaaatcaattcaatctttagcgttggggtatcaagcaaaa
gtattggaaaatagcgatgcttcaatagcgataggtgtatcaggagaaacaaaaataatc
aattctaaatggtcaaccgcattaggaaacaaaatagccataacaggttccgataataac
attcttgcattgggaagtaatattagtgtaggaactaacaatgcaaatttaatcataata
ggaaatggtgagaacggcggaagtaatggcacaataacaaacgccaaaaattcagtgatt
atcggtaaacatgcaatttctcaagctgaaagtgcggtggtgattggtaaagatgcaact
gttcaagcaagtgccataggtgcggtagcgattggggagggtgcgtctgtatccactaat
gcaggggattcgattgctttaggtaaaggttctaaggcagaagataagaaacaagcattt
aaaacacaagagttaagtgttaatggcagttatagcctattatttaaatgggaaaatgct
ggaacatctgcatccgattctgataaaaaatccgtgctaagtataggggatatgggacgt
gaaagagttattagacatgttgctgcgggtgaaattagggacggttccacagatgcgatc
aacggtgggcaattaaaaggcgttatcgatgtattcggctatttaggaaccgacgtatta
ggtgcagaaaaagccgaaactaacaaagccggttttaaacaaactacgtttactaagttg
aaagataaaaacggagctgagacaaatccagcttcaacaacatttaaagacgctattacc
aaaaacattgagaaaatcaacgagggcttaaaattcaaagtcgaaaacggcacaagtgcg
ggcggttctgctggaaattcaactgaaatgacccgtcaactcggagcgacggttaccttt
aaaggcggaaaacacctcaaagcaacgattgatagctcaaaaggcgaaatttcctttgaa
gcggagtcaaccgacacaattaatgatactcaacaaaatagtgggggaagttcaggtagt
tcaagcaacaaacttgtaactgaaactgcggtgaaaacctacataacccaaaaactccaa
aatgttggtggtacgttgcaactagagggggataacacccaaaacggaagcacccctgcc
aaccctgttggtaaagttgagttaaataaacacaaactaaaaataacaggtgaaagtgat
ttcatcaaaacagaagttacacaagacaaaccaaccgtaaccatcaaacttgccgaccaa
gtgaagaaaaaattggaagtgattactgttaatggcaacggcgataattcctttgcgttg
ggtaaaggttctgaaattgttaagaaaaagaccgcacctagtggaactacacaaaacaca
ggacaaagtgaagtaacaatcagctggaaaaacgccggtgcttctgctgatacaatggaa
ggcaataaaaaagaagtcgtcagcgttggttctacaggctcagaacgcattatcacccat
gtcgccgcaggtgaagtaagggacggttcaactgatgcaattaacggcggacagctttac
aacgttattcaagtattcggaaaactgggtacggaagtattgggtgcagagaaaaatgat
agaggagatggctttaagaaaactacatttactgcattgaaagatacaagtggtggaaat
caagcgactaaagacacatttaaagatgcaattaatgccaatatctccaaaatcaacgag
gggctaaaatttgcagtggaaactggtggtggagctcaatcatcaatggcgagtggaaac
ggtcctttaacccgtcaacttggctcaacgctaacgtttggtggggatagttaccttacg
cctagccttgataacagcggtggtaaaattacctttaagctcaaagtggctacttctatt
agtgatacaaattcaggcagtacaactgaccaaaacgacaataaactggttaccgcaagt
gcggttaaagaatacttgaaaaatcaattgaattcattaacgctaaaaattgaagctgat
aattccaataccgcacaagcacaagccggtggacaagctcaaagtgcggctccaagtacg
ccgtcttctagcggacaatctcaatcctcaaacggaaaagtccaaggtgctgttaaaatt
caaagtcaagccttgcaggttttgggaacaacagatgagattgaaacgaaagttgaagat
aagcaacaaaaagttactatcaaacttgctgaccaagtaaagaaaaagctagatgtaatt
acagttaatggtaaagacggcgataattcctttgcgttaggcgatggttctcaaatcgtg
aataaaaagaccgcacctagtggaacaatacaaaatgtaggtggaaatgatataaaaatc
agctggtcagcaggtgttggggctaataaagaagtcatcagcgtgggtaagaaagatgct
gaacgcattattacttatgtcgccgccggtgaagtcaaagatacctcaactgatgccgtc
aatggtggacagctttacaatgttattcaggtattcggtaaactcggtacggacgtatta
ggggcggagaaagatgatagcggtgatggttttaagaaaactacgtttaccgcattaaac
aaagaagatggcactaaaaataaggctaccacgacatttaaagaagccattgatgaaagc
attaaaaccattaacaaaggtttaatttttgaggtggacgatggtactacaacaacagca
actacgaccgcacctcaaaccggcggtacatcaaccaacaaaatgacccgtcagcttggg
gctacgattaaatttaaaggcgatgactatatcaaaccgagtattgatgccgacaccgga
acaatttccttcaaaatagaggcaactgaagaaattaaggaaaatggaagtgcggacggt
tctagcggaaattctagtgctgaggacaaaaaacttactacagctaaggcggtgaaagac
tttgtaaacagcaaaatcaagaccatcaccgaccaacagacagaagcggataaaatagcg
gtgaaatatgatgatgaacataaaaaatcaatcactttaggcggtaaacctcaaaatgga
ggtaaggctcatgaccctgttgccatcaaaaatctaaaatccgccttgggaattgataat
gatagtatgaaaggtaagtctgaatctgaaaaacaaggtaaatcccttgatctagtgaaa
aaactggtttccaacggcataagtagccagcaagggcaaaaaatgactgagcaacaagat
ctgcatcaagccgccaatctcgctgacttaaaagcggttgcacaagctgggttgagattt
aaaggaaatcagggcgatgatgtagtcagaaaaatcagcgataccttaaccattaaaggg
gaagaggaaactcaaaacggtcaagctacaagttcatttagtagtgccgctggtaacatt
aaggtagaaaccaatacagccaaagatggtttagaaataaaactgtcggataccttgaaa
aatatgaaagcctttgaaaccaaagaggagggcggtaaaaaagccacgttaaatagcgag
ggcttaaaagttgtcaacaacaaaaatggtaatggcaaagacatctctgccacctatggt
gcggacaatatcatgttggaagataagaaaactggcaataaagcaacaataactgctgaa
agcctgacctttgctgacaacgcaacgacacaaaatcagcaaaatccaaaaatgccaaaa
gctgttcttaataaaaacggcttaaccgtaaccggagcaaacggtgaaattaagattgat
ggtgaaaaaggtattattaccgtgccggatattaaaccaacaaccagtggaagtgcggtg
gtgaataaaaaatatgtggatactttacaaagacaaaccgaccaaaaactcagcaatctc
aacaataaactggatatgtccaataaagaattgcgagcggggattgcgggtgctttggca
acttcaggtttgccgatgtcttctgtgccgggtaaatccatgtttgctgcttcggcaggt
tcctataaaggacaaagtgcggtggcgttaggttattcacgagtaagtgataatggtaaa
ataacgctacgattgcaaggtactcgcagttcaacgggcgatgtcggcggttcggttggt
gtggggtatcagtggtaa

DBGET integrated database retrieval system